Mouse NFKBIE Monoclonal Antibody | anti-NFKBIE antibody

NFKBIE (Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, epsilon, IKBE) (Biotin)

Cat. Num. AAA6174727

• Gene Names: NFKBIE; IKBE
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: NFKBIE; Monoclonal Antibody; NFKBIE (Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor; epsilon; IKBE) (Biotin); Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor; IKBE; anti-NFKBIE antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F12
• Specificity: Recognizes NFKBIE.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-NFKBIE antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NFKBIE (NP_004547, 403aa-498aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKISGKLLLC
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NFKBIE is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-NFKBIE antibody

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine). For some genes, activation requires NFKB interaction with other transcription factors, such as STAT (see STAT6, MIM 601512), AP1 (JUN, MIM 165160), and NFAT (see NFATC1, MIM 600489). [supplied by OMIM]

Product Categories/Family for anti-NFKBIE antibody

Antibodies; Protein Kinase Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 71274109
• NCBI GeneID: 4794
• NCBI Accession #: NP_004547
• NCBI GenBank Nucleotide #: NM_004556
• UniProt Accession #: O00221
• Molecular Weight: 53kDa
• NCBI Official Full Name: NF-kappa-B inhibitor epsilon
• NCBI Official Synonym Full Names: NFKB inhibitor epsilon
• NCBI Official Symbol: NFKBIE
• NCBI Official Synonym Symbols: IKBE
• NCBI Protein Information: NF-kappa-B inhibitor epsilon
• UniProt Protein Name: NF-kappa-B inhibitor epsilon
• Protein Family: NF-kappa-B inhibitor
• UniProt Gene Name: NFKBIE
• UniProt Synonym Gene Names: IKBE; NF-kappa-BIE; IkB-E; IkB-epsilon
• UniProt Entry Name: IKBE_HUMAN

NCBI Description

The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, which activates NF-kappa-B by making it available to translocate to the nucleus. [provided by RefSeq, Sep 2011]

Uniprot Description

IkB-epsilon: Inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. Inhibits DNA-binding of NF-kappa-B p50-p65 and p50-c-Rel complexes. Interacts with RELA, REL, NFKB1 nuclear factor NF-kappa-B p50 subunit and NFKB2 nuclear factor NF-kappa-B p52 subunit. Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages. Belongs to the NF-kappa-B inhibitor family.

Protein type: Inhibitor; DNA-binding

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; cytoplasm; cytosol

Molecular Function: protein binding

Biological Process: cytoplasmic sequestering of transcription factor; D-serine transport