Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NFIC Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human NFIC Polyclonal Antibody | anti-NFIC antibody

NFIC antibody - C-terminal region

Gene Names
NFIC; CTF; NFI; CTF5; NF-I
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
NFIC; Polyclonal Antibody; NFIC antibody - C-terminal region; anti-NFIC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQ
Sequence Length
428
Applicable Applications for anti-NFIC antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFIC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NFIC Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NFIC Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NFIC antibody
This is a rabbit polyclonal antibody against NFIon Channel. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Brg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptional activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RNAP II, and this interaction is closely dependent on the activation of gene transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
nuclear factor 1 C-type isoform 5
NCBI Official Synonym Full Names
nuclear factor I C
NCBI Official Symbol
NFIC
NCBI Official Synonym Symbols
CTF; NFI; CTF5; NF-I
NCBI Protein Information
nuclear factor 1 C-type
UniProt Protein Name
Nuclear factor 1 C-type
Protein Family
UniProt Gene Name
NFIC
UniProt Synonym Gene Names
NFI; NF1-C; Nuclear factor 1/C; CTF; NF-I/C; NFI-C

NCBI Description

The protein encoded by this gene belongs to the CTF/NF-I family. These are dimeric DNA-binding proteins, and function as cellular transcription factors and as replication factors for adenovirus DNA replication. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NFI-C: Recognizes and binds the palindromic sequence 5'- TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. Belongs to the CTF/NF-I family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleolus; nucleus

Molecular Function: transcription factor activity

Biological Process: negative regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter

Research Articles on NFIC

Similar Products

Product Notes

The NFIC nfic (Catalog #AAA3224614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFIC antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFIC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFIC nfic for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRERDAEQSG SPRTGMGSDQ EDSKPITLDT TDFQESFVTS GVFSVTELIQ. It is sometimes possible for the material contained within the vial of "NFIC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.