Western Blot (WB)
(Western blot-NFATC2IP Polyclonal Antibody)
Rabbit anti-Human NFATC2IP Polyclonal Antibody | anti-NFATC2IP antibody
NFATC2IP Polyclonal Antibody
Gene Names
NFATC2IP; ESC2; NIP45; RAD60
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NFATC2IP; Polyclonal Antibody; NFATC2IP Polyclonal Antibody; ESC2; NIP45; RAD60; NFATC2-interacting protein; anti-NFATC2IP antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.31 mg/ml (varies by lot)
Sequence Length
313
Applicable Applications for anti-NFATC2IP antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 290-360 of human NFATC2IP (NP_116204.3).
Immunogen Sequence
VDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQT
Positive Samples
U-87MG, LO2
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-NFATC2IP Polyclonal Antibody)
Western Blot (WB)
(Western blot-NFATC2IP Polyclonal Antibody)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 13kDa; 15kDa; 45kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
NFATC2IP protein, partial
NCBI Official Synonym Full Names
nuclear factor of activated T cells 2 interacting protein
NCBI Official Symbol
NFATC2IP
NCBI Official Synonym Symbols
ESC2; NIP45; RAD60
NCBI Protein Information
NFATC2-interacting protein
UniProt Protein Name
NFATC2-interacting protein
Protein Family
UniProt Gene Name
NFATC2IP
UniProt Synonym Gene Names
NIP45; 45 kDa NFAT-interacting protein
UniProt Entry Name
NF2IP_HUMAN
Uniprot Description
NFATC2IP: In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2. Recruits PRMT1 to the IL4 promoter; this leads to enhancement of histone H4 'Arg-3'- methylation and facilitates subsequent histone acetylation at the IL4 locus, thus promotes robust cytokine expression. Down-regulates formation of poly-SUMO chains by UBE2I/UBC9. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Transcription, coactivator/corepressor
Chromosomal Location of Human Ortholog: 16p11.2
Cellular Component: cytoplasm; nucleus
Biological Process: cytokine production; positive regulation of transcription from RNA polymerase II promoter
Research Articles on NFATC2IP
Similar Products
Product Notes
The NFATC2IP nfatc2ip (Catalog #AAA9140753) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFATC2IP Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC2IP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NFATC2IP nfatc2ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFATC2IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
