Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of NFATC2IP transfected lysate using NFATC2IP rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NFATC2IP mouse polyclonal antibody.)

Rabbit anti-Human NFATC2IP Polyclonal Antibody | anti-NFATC2IP antibody

NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387)

Gene Names
NFATC2IP; ESC2; NIP45; RAD60
Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
NFATC2IP; Polyclonal Antibody; NFATC2IP (Nuclear Factor Of Activated T-Cells; Cytoplasmic; Calcineurin-Dependent 2 Interacting Protein; FLJ14639; MGC126790; MGC138387); Anti -NFATC2IP (Nuclear Factor Of Activated T-Cells; anti-NFATC2IP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NFATC2IP.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Applicable Applications for anti-NFATC2IP antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human NFATC2IP, aa1-138 (AAH21551.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of NFATC2IP transfected lysate using NFATC2IP rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NFATC2IP mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NFATC2IP transfected lysate using NFATC2IP rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NFATC2IP mouse polyclonal antibody.)
Related Product Information for anti-NFATC2IP antibody
Plays a role in the inducible expression of cytokine genes in T-cells, especially by increasing NFAT-driven IL-4 production.
Product Categories/Family for anti-NFATC2IP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
45,817 Da
NCBI Official Full Name
NFATC2IP protein, partial
NCBI Official Synonym Full Names
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
NCBI Official Symbol
NFATC2IP
NCBI Official Synonym Symbols
ESC2; NIP45; RAD60
NCBI Protein Information
NFATC2-interacting protein; 45 kDa NFAT-interacting protein; 45 kDa NF-AT-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
UniProt Protein Name
NFATC2-interacting protein
UniProt Gene Name
NFATC2IP
UniProt Synonym Gene Names
NIP45; 45 kDa NFAT-interacting protein
UniProt Entry Name
NF2IP_HUMAN

Uniprot Description

NFATC2IP: In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2. Recruits PRMT1 to the IL4 promoter; this leads to enhancement of histone H4 'Arg-3'- methylation and facilitates subsequent histone acetylation at the IL4 locus, thus promotes robust cytokine expression. Down-regulates formation of poly-SUMO chains by UBE2I/UBC9. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytoplasm; nucleus

Biological Process: cytokine production; positive regulation of transcription from RNA polymerase II promoter

Research Articles on NFATC2IP

Similar Products

Product Notes

The NFATC2IP nfatc2ip (Catalog #AAA6007494) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC2IP can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the NFATC2IP nfatc2ip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEPLQSVVD HMATHLGVSP SRILLLFGET ELSPTATPRT LKLGVADIID CVVLTSSPEA TETSQQLQLR VQGKEKHQTL EVSLSRDSPL KTLMSHYEEA MGLSGRKLSF FFDGTKLSGR ELPADLGMES GDLIEVWG. It is sometimes possible for the material contained within the vial of "NFATC2IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.