Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NEUROD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human cerebellum)

Rabbit NEUROD2 Polyclonal Antibody | anti-NEUROD2 antibody

NEUROD2 antibody - C-terminal region

Gene Names
NEUROD2; NDRF; bHLHa1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEUROD2; Polyclonal Antibody; NEUROD2 antibody - C-terminal region; anti-NEUROD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN
Sequence Length
382
Applicable Applications for anti-NEUROD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NEUROD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NEUROD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human cerebellum)

Western Blot (WB) (WB Suggested Anti-NEUROD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human cerebellum)
Related Product Information for anti-NEUROD2 antibody
This is a rabbit polyclonal antibody against NEUROD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NEUROD2 is a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of NEUROD2 can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. NEUROD2 can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates.This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
neurogenic differentiation factor 2
NCBI Official Synonym Full Names
neuronal differentiation 2
NCBI Official Symbol
NEUROD2
NCBI Official Synonym Symbols
NDRF; bHLHa1
NCBI Protein Information
neurogenic differentiation factor 2
UniProt Protein Name
Neurogenic differentiation factor 2
UniProt Gene Name
NEUROD2
UniProt Synonym Gene Names
BHLHA1; NDRF; NeuroD2; bHLHa1; NDRF
UniProt Entry Name
NDF2_HUMAN

NCBI Description

This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008]

Uniprot Description

NEUROD2: Transcriptional regulator implicated in neuronal determination. Mediates calcium-dependent transcription activation by binding to E box-containing promoter. Critical factor essential for the repression of the genetic program for neuronal differentiation; prevents the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Induces transcription of ZEB1, which in turn represses neuronal differentiation by down-regulating REST expression. Plays a role in the establishment and maturation of thalamocortical connections; involved in the segregation of thalamic afferents into distinct barrel domains within layer VI of the somatosensory cortex. Involved in the development of the cerebellar and hippocampal granular neurons, neurons in the basolateral nucleus of amygdala and the hypothalamic-pituitary axis. Associates with chromatin to the DPYSL3 E box-containing promoter.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleus

Molecular Function: protein heterodimerization activity; transcription factor activity; transcription corepressor activity

Biological Process: nervous system development; behavioral fear response; transcription, DNA-dependent; positive regulation of synaptic plasticity; protein ubiquitination; positive regulation of calcium-mediated signaling; regulation of transcription from RNA polymerase II promoter; cerebellar cortex development; neuron development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of neuron differentiation; associative learning

Research Articles on NEUROD2

Similar Products

Product Notes

The NEUROD2 neurod2 (Catalog #AAA3204250) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEUROD2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEUROD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEUROD2 neurod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGSRPTGHGL VFGSSAVRGG VHSENLLSYD MHLHHDRGPM YEELNAFFHN. It is sometimes possible for the material contained within the vial of "NEUROD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.