Western Blot (WB)
(WB Suggested Anti-Nek7 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
Rabbit Nek7 Polyclonal Antibody | anti-NEK7 antibody
Nek7 antibody - C-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nek7; Polyclonal Antibody; Nek7 antibody - C-terminal region; anti-NEK7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTA
Sequence Length
302
Applicable Applications for anti-NEK7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Nek7 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
Western Blot (WB)
(WB Suggested Anti-Nek7 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Liver)
Related Product Information for anti-NEK7 antibody
This is a rabbit polyclonal antibody against Nek7. It was validated on Western Blot
Target Description: Nek7 is a protein kinase which plays an important role in mitotic cell cycle progression. It is required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis. Nek7 phosphorylates RPS6KB1.
Target Description: Nek7 is a protein kinase which plays an important role in mitotic cell cycle progression. It is required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis. Nek7 phosphorylates RPS6KB1.
Product Categories/Family for anti-NEK7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
serine/threonine-protein kinase Nek7
NCBI Official Synonym Full Names
NIMA-related kinase 7
NCBI Official Symbol
Nek7
NCBI Protein Information
serine/threonine-protein kinase Nek7
UniProt Protein Name
Serine/threonine-protein kinase Nek7
Protein Family
UniProt Gene Name
Nek7
UniProt Synonym Gene Names
NimA-related protein kinase 7
Uniprot Description
Protein kinase which plays an important role in mitotic cell cycle progression. Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis. Phosphorylates RPS6KB1. releasing the autoinhibitory function of Tyr-97 ().
Similar Products
Product Notes
The NEK7 nek7 (Catalog #AAA3209281) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nek7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Nek7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEK7 nek7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQCDYPPLPS DHYSEELRQL VNICINPDPE KRPDIAYVYD VAKRMHACTA. It is sometimes possible for the material contained within the vial of "Nek7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
