Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NEK2Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NEK2 Polyclonal Antibody | anti-NEK2 antibody

NEK2 Antibody - N-terminal region

Gene Names
NEK2; NLK1; RP67; NEK2A; HsPK21; PPP1R111
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEK2; Polyclonal Antibody; NEK2 Antibody - N-terminal region; anti-NEK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGT
Sequence Length
437
Applicable Applications for anti-NEK2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NEK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NEK2Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NEK2Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NEK2 antibody
This is a rabbit polyclonal antibody against NEK2. It was validated on Western Blot

Target Description: This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.
Product Categories/Family for anti-NEK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
serine/threonine-protein kinase Nek2 isoform 1
NCBI Official Synonym Full Names
NIMA related kinase 2
NCBI Official Symbol
NEK2
NCBI Official Synonym Symbols
NLK1; RP67; NEK2A; HsPK21; PPP1R111
NCBI Protein Information
serine/threonine-protein kinase Nek2
UniProt Protein Name
Serine/threonine-protein kinase Nek2
UniProt Gene Name
NEK2
UniProt Synonym Gene Names
NEK2A; NLK1; NimA-related protein kinase 2
UniProt Entry Name
NEK2_HUMAN

NCBI Description

This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

NEK2: a protein kinase of the NEK family. Accumulates throughout S phase and shows maximal levels in late G2. This expression pattern is highly reminiscent of that of A and B cyclins. Phosphorylation of Hec1 by Nek2 is essential for faithful chromosome segregation

Protein type: Protein kinase, Other; Kinase, protein; EC 2.7.11.1; Nucleolus; Protein kinase, Ser/Thr (non-receptor); Other group; NEK family

Chromosomal Location of Human Ortholog: 1q32.3

Cellular Component: kinetochore; spindle pole; centrosome; microtubule; intercellular bridge; condensed nuclear chromosome; protein complex; cytoplasm; nucleolus; midbody; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; protein phosphatase binding; ATP binding; protein kinase activity

Biological Process: mitosis; blastocyst development; regulation of attachment of spindle microtubules to kinetochore; mitotic sister chromatid segregation; organelle organization and biogenesis; protein amino acid autophosphorylation; regulation of mitotic centrosome separation; centrosome separation; spindle assembly; protein amino acid phosphorylation; negative regulation of DNA binding; chromosome segregation; meiotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; cell division; regulation of mitosis; mitotic cell cycle; G2/M transition of mitotic cell cycle

Disease: Retinitis Pigmentosa 67

Research Articles on NEK2

Similar Products

Product Notes

The NEK2 nek2 (Catalog #AAA3209082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEK2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NEK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEK2 nek2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSDGGHTVLH RDLKPANVFL DGKQNVKLGD FGLARILNHD TSFAKTFVGT. It is sometimes possible for the material contained within the vial of "NEK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.