Western Blot (WB)
(Host: RabbitTarget Name: NefmSample Type: Rat Muscle lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Nefm Polyclonal Antibody | anti-NEFM antibody
Nefm Antibody - C-terminal region
Gene Names
Nefm; Nfm; Nef3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nefm; Polyclonal Antibody; Nefm Antibody - C-terminal region; anti-NEFM antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ
Sequence Length
845
Applicable Applications for anti-NEFM antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nefm
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NefmSample Type: Rat Muscle lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NefmSample Type: Rat Muscle lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NEFM antibody
This is a rabbit polyclonal antibody against Nefm. It was validated on Western Blot
Target Description: Nefm is a neuronal intermediate filament protein and an important component of the cytoskeleton.
Target Description: Nefm is a neuronal intermediate filament protein and an important component of the cytoskeleton.
Product Categories/Family for anti-NEFM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
neurofilament medium polypeptide
NCBI Official Synonym Full Names
neurofilament medium
NCBI Official Symbol
Nefm
NCBI Official Synonym Symbols
Nfm; Nef3
NCBI Protein Information
neurofilament medium polypeptide
UniProt Protein Name
Neurofilament medium polypeptide
Protein Family
UniProt Gene Name
Nefm
UniProt Synonym Gene Names
Nef3; Nfm; NF-M
UniProt Entry Name
NFM_RAT
NCBI Description
neuronal intermediate filament protein; important component of the cytoskeleton [RGD, Feb 2006]
Research Articles on NEFM
Similar Products
Product Notes
The NEFM nefm (Catalog #AAA3217101) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nefm Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Nefm can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEFM nefm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGDGATKYIT KSVTVTQKVE EHEETFEEKL VSTKKVEKVT SHAIVKEVTQ. It is sometimes possible for the material contained within the vial of "Nefm, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
