Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFS5 expression in human liver using 130241.)

Rabbit anti-Human NDUFS5 Polyclonal Antibody | anti-NDUFS5 antibody

NDUFS5 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 5, Complex I-15kD, CI-15kD, NADH-ubiquinone Oxidoreductase 15kD Subunit) (Biotin)

Gene Names
NDUFS5; CI15K; CI-15k
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFS5; Polyclonal Antibody; NDUFS5 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 5; Complex I-15kD; CI-15kD; NADH-ubiquinone Oxidoreductase 15kD Subunit) (Biotin); anti-NDUFS5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFS5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NDUFS5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-106 from human NDUFS5 (NP_004543.1).
Immunogen Sequence
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFS5 expression in human liver using 130241.)

Western Blot (WB) (Western Blot analysis of NDUFS5 expression in human liver using 130241.)

Western Blot (WB)

(Western Blot analysis of NDUFS5 expression in transfected 293T cell line by 130241. Lane 1: NDUFS5 transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFS5 expression in transfected 293T cell line by 130241. Lane 1: NDUFS5 transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NDUFS5 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFS5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,518 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
NCBI Official Symbol
NDUFS5
NCBI Official Synonym Symbols
CI15K; CI-15k
NCBI Protein Information
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; CI-15 kDa; complex I-15 kDa; NADH:ubiquinone oxidoreductase 15 kDa IP subunit
UniProt Protein Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
UniProt Gene Name
NDUFS5
UniProt Synonym Gene Names
CI-15 kDa
UniProt Entry Name
NDUS5_HUMAN

NCBI Description

This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17. [provided by RefSeq, May 2010]

Uniprot Description

NDUFS5: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFS5 subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; Mitochondrial

Chromosomal Location of Human Ortholog: 1p34.2-p33

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial respiratory chain complex I assembly; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFS5

Similar Products

Product Notes

The NDUFS5 ndufs5 (Catalog #AAA6386745) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFS5 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 5, Complex I-15kD, CI-15kD, NADH-ubiquinone Oxidoreductase 15kD Subunit) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFS5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFS5 ndufs5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.