Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 Recombinant Protein | NDUFS5 recombinant protein

Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

Gene Names
NDUFS5; CI15K; CI-15k
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; Complex I-15 kDa; CI-15 kDa; NADH-ubiquinone oxidoreductase 15 kDa subunit; NDUFS5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-106aa; Full Length
Sequence
PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP
Sequence Length
106
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for NDUFS5 recombinant protein
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for NDUFS5 recombinant protein
References
Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.Mao M., Fu G., Wu J.-S., Zhang Q.-H., Zhou J., Kan L.-X., Huang Q.-H., He K.-L., Gu B.-W., Han Z.-G., Shen Y., Gu J., Yu Y.-P., Xu S.-H., Wang Y.-X., Chen S.-J., Chen Z.Proc. Natl. Acad. Sci. U.S.A. 95:8175-8180(1998) The human NADH:ubiquinone oxidoreductase NDUFS5 (15 kDa) subunit cDNA cloning, chromosomal localization, tissue distribution and the absence of mutations in isolated complex I-deficient patients.Loeffen J., Smeets R., Smeitink J., Triepels R., Sengers R., Trijbels F., van den Heuvel L.J. Inherit. Metab. Dis. 22:19-28(1999) The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.Murray J., Zhang B., Taylor S.W., Oglesbee D., Fahy E., Marusich M.F., Ghosh S.S., Capaldi R.A.J. Biol. Chem. 278:13619-13622(2003) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I.Szklarczyk R., Wanschers B.F., Nabuurs S.B., Nouws J., Nijtmans L.G., Huynen M.A.FEBS Lett. 585:737-743(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) High-throughput, pooled sequencing identifies mutations in NUBPL and FOXRED1 in human complex I deficiency.Calvo S.E., Tucker E.J., Compton A.G., Kirby D.M., Crawford G., Burtt N.P., Rivas M., Guiducci C., Bruno D.L., Goldberger O.A., Redman M.C., Wiltshire E., Wilson C.J., Altshuler D., Gabriel S.B., Daly M.J., Thorburn D.R., Mootha V.K.Nat. Genet. 42:851-858(2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.4 kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit S5
NCBI Official Symbol
NDUFS5
NCBI Official Synonym Symbols
CI15K; CI-15k
NCBI Protein Information
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
UniProt Protein Name
NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
UniProt Gene Name
NDUFS5
UniProt Synonym Gene Names
CI-15 kDa
UniProt Entry Name
NDUS5_HUMAN

NCBI Description

This gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. Alternative splicing results in multiple transcript variants and pseudogenes have been identified on chromosomes 1, 4 and 17. [provided by RefSeq, May 2010]

Uniprot Description

NDUFS5: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFS5 subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; Mitochondrial

Chromosomal Location of Human Ortholog: 1p34.2-p33

Cellular Component: mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrial respiratory chain complex I; mitochondrion

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone; mitochondrial respiratory chain complex I assembly

Research Articles on NDUFS5

Similar Products

Product Notes

The NDUFS5 ndufs5 (Catalog #AAA717194) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-106aa; Full Length. The amino acid sequence is listed below: PFLDIQKRFG LNIDRWLTIQ SGEQPYKMAG RCHAFEKEWI ECAHGIGYTR AEKECKIEYD DFVECLLRQK TMRRAGTIRK QRDKLIKEGK YTPPPHHIGK GEPRP. It is sometimes possible for the material contained within the vial of "NADH dehydrogenase [ubiquinone] iron-sulfur protein 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.