Rabbit anti-Human, Mouse NDUFS3 Polyclonal Antibody | anti-NDUFS3 antibody

NDUFS3 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 3, Mitochondrial, Complex I-30kD, CI-30kD, NADH-ubiquinone Oxidoreductase 30kD Subunit) (Biotin)

Cat. Num. AAA6386734

• Gene Names: NDUFS3; CI-30
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFS3; Polyclonal Antibody; NDUFS3 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 3; Mitochondrial; Complex I-30kD; CI-30kD; NADH-ubiquinone Oxidoreductase 30kD Subunit) (Biotin); anti-NDUFS3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NDUFS3. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-NDUFS3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NDUFS3, aa1-264 (NP_004542.1).
• Immunogen Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NDUFS3 rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in human pancreas)

Western Blot (WB)

(NDUFS3 rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in mouse kidney.)

Western Blot (WB)

(NDUFS3 rabbit polyclonal antibody. Western Blot analysis of NDUFS3 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 polyclonal antibody. Lane 1: NDUFS3 transfected lysate (30.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NDUFS3 antibody

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Product Categories/Family for anti-NDUFS3 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 4758788
• NCBI GeneID: 4722
• NCBI Accession #: NP_004542.1
• NCBI GenBank Nucleotide #: NM_004551.1
• UniProt Accession #: O75489; Q9UNQ8; B2R9J1
• Molecular Weight: 30,242 Da
• NCBI Official Full Name: NADH dehydrogenase
• NCBI Official Synonym Full Names: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
• NCBI Official Symbol: NDUFS3
• NCBI Official Synonym Symbols: CI-30
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial; CI-30kD; complex I-30kD; complex I 30kDa subunit; NADH dehydrogenase-ubiquinone 30 kDa subunit; NADH-ubiquinone oxi
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
• UniProt Gene Name: NDUFS3
• UniProt Synonym Gene Names: CI-30kD
• UniProt Entry Name: NDUS3_HUMAN

NCBI Description

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.[provided by RefSeq, Apr 2009]

Uniprot Description

NDUFS3: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I 30 kDa subunit family.

Protein type: Oxidoreductase; EC 1.6.99.3; EC 1.6.5.3; Mitochondrial; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 11p11.11

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial membrane; nucleus; mitochondrial respiratory chain complex I

Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity; electron carrier activity; NADH dehydrogenase activity

Biological Process: cellular metabolic process; substantia nigra development; mitochondrial electron transport, NADH to ubiquinone; negative regulation of cell growth

Disease: Leigh Syndrome; Mitochondrial Complex I Deficiency