Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NDUB8Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NDUFB8 Polyclonal Antibody | anti-NDUFB8 antibody

NDUFB8 Antibody - N-terminal region

Gene Names
NDUFB8; ASHI; CI-ASHI; MC1DN32
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NDUFB8; Polyclonal Antibody; NDUFB8 Antibody - N-terminal region; anti-NDUFB8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRL
Sequence Length
186
Applicable Applications for anti-NDUFB8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUB8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NDUB8Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NDUB8Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NDUFB8 antibody
This is a rabbit polyclonal antibody against NDUB8. It was validated on Western Blot
Product Categories/Family for anti-NDUFB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit B8
NCBI Official Symbol
NDUFB8
NCBI Official Synonym Symbols
ASHI; CI-ASHI; MC1DN32
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
UniProt Gene Name
NDUFB8
UniProt Synonym Gene Names
CI-ASHI
UniProt Entry Name
NDUB8_HUMAN

Uniprot Description

NDUFB8: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFB8 subunit family.

Protein type: Endoplasmic reticulum; Energy Metabolism - oxidative phosphorylation; Oxidoreductase; EC 1.6.99.3; Membrane protein, integral; Mitochondrial; EC 1.6.5.3

Chromosomal Location of Human Ortholog: 10q24.31

Cellular Component: endoplasmic reticulum; mitochondrial inner membrane; integral to membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFB8

Similar Products

Product Notes

The NDUFB8 ndufb8 (Catalog #AAA3219784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFB8 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFB8 ndufb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAKKYNMRV EDYEPYPDDG MGYGDYPKLP DRSQHERDPW YSWDQPGLRL. It is sometimes possible for the material contained within the vial of "NDUFB8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.