Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFB1 expression in transfected 293T cell line by NDUFB1 polyclonal antibody. Lane 1: NDUFB1 transfected lysate (11.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NDUFB1 Polyclonal Antibody | anti-NDUFB1 antibody

NDUFB1 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 1, Complex I-MNLL, CI-MNLL, NADH-ubiquinone Oxidoreductase MNLL Subunit) (FITC)

Gene Names
NDUFB1; MNLL; CI-MNLL; CI-SGDH
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFB1; Polyclonal Antibody; NDUFB1 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 1; Complex I-MNLL; CI-MNLL; NADH-ubiquinone Oxidoreductase MNLL Subunit) (FITC); anti-NDUFB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-NDUFB1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NDUFB1, aa1-105 (NP_004536.2).
Immunogen Sequence
MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFB1 expression in transfected 293T cell line by NDUFB1 polyclonal antibody. Lane 1: NDUFB1 transfected lysate (11.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFB1 expression in transfected 293T cell line by NDUFB1 polyclonal antibody. Lane 1: NDUFB1 transfected lysate (11.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NDUFB1 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,961 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa
NCBI Official Symbol
NDUFB1
NCBI Official Synonym Symbols
MNLL; CI-MNLL; CI-SGDH
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; complex I-MNLL; complex I MNLL subunit; NADH-ubiquinone oxidoreductase MNLL subunit
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Protein Family
UniProt Gene Name
NDUFB1
UniProt Synonym Gene Names
CI-MNLL
UniProt Entry Name
NDUB1_HUMAN

Uniprot Description

NDUFB1: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFB1 subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q32.12

Cellular Component: mitochondrial inner membrane; integral to membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Similar Products

Product Notes

The NDUFB1 ndufb1 (Catalog #AAA6386658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFB1 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 1, Complex I-MNLL, CI-MNLL, NADH-ubiquinone Oxidoreductase MNLL Subunit) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFB1 ndufb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.