Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human NDUFA1 Polyclonal Antibody | anti-NDUFA1 antibody

NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1, Complex I-MWFE, CI-MWFE, NADH-ubiquinone Oxidoreductase MWFE Subunit)

Gene Names
NDUFA1; MWFE; ZNF183; CI-MWFE
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NDUFA1; Polyclonal Antibody; NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone Oxidoreductase MWFE Subunit); Anti -NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1; anti-NDUFA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFA1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Applicable Applications for anti-NDUFA1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NDUFA1, aa1-70 (AAH00266.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-NDUFA1 antibody
NDUFA1 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1) is an essential component of the multisubunit NADH ubiquinone oxidoreductase (complex 1), the first enzyme complex in the mitochondrial respiratory chain. Complex I transfers electrons from NADH to the respiratory chain via ubiquinone.
Product Categories/Family for anti-NDUFA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,072 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
NCBI Official Symbol
NDUFA1
NCBI Official Synonym Symbols
MWFE; ZNF183; CI-MWFE
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; complex I-MWFE; type I dehydrogenase; complex I MWFE subunit; NADH oxidoreductase subunit MWFE; NADH:ubiquinone oxidoreductase (complex 1); NADH-ubiquinone oxidoreductase MWFE subunit
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
UniProt Gene Name
NDUFA1
UniProt Synonym Gene Names
CI-MWFE
UniProt Entry Name
NDUA1_HUMAN

NCBI Description

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Subunit structure: Complex I is composed of 45 different subunits. Ref.5

Subcellular location: Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Tissue specificity: Primarily expressed in heart and skeletal muscle.

Involvement in disease: Mitochondrial complex I deficiency (MT-C1D) [MIM:252010]: A disorder of the mitochondrial respiratory chain that causes a wide range of clinical manifestations from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.7

Sequence similarities: Belongs to the complex I NDUFA1 subunit family.

Research Articles on NDUFA1

Similar Products

Product Notes

The NDUFA1 ndufa1 (Catalog #AAA649738) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1, Complex I-MWFE, CI-MWFE, NADH-ubiquinone Oxidoreductase MWFE Subunit) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NDUFA1 ndufa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWFEILPGLS VMGVCLLIPG LATAYIHRFT NGGKEKRVAH FGYHWSLMER DRRISGVDRY YVSKGLENID. It is sometimes possible for the material contained within the vial of "NDUFA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.