NDRG2 Polyclonal Antibody | anti-NDRG2 antibody

Anti-NDRG2 Antibody

Cat. Num. AAA177681

• Gene Names: NDRG2; SYLD
• Reactivity: Mouse, Rat; Predicted to work with: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: NDRG2; Polyclonal Antibody; Anti-NDRG2 Antibody; Protein NDRG2; Antidepressant related protein ADRG123; Cytoplasmic protein Ndr1; DKFZp781G1938; FLJ25522; KIAA1248; N myc downstream regulated gene 2; N myc downstream regulator 2; NDR1 related protein NDR2; NDRG 2; NDRG family member 2; NDRG1 related protein; NDRG2_HUMAN; Protein Syld709613; SYLD; Syld709613 protein antibody; anti-NDRG2 antibody

• Reactivity: Mouse, Rat; Predicted to work with: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 367

• Applicable Applications for anti-NDRG2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER), different from the related mouse and rat sequences by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- NDRG2 Picoband antibody, MBS177681, Western blottingAll lanes: Anti NDRG2 (MBS177681) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 41KDObserved bind size: 41KD)

Immunohistochemistry (IHC)

(Anti- NDRG2 Picoband antibody, MBS177681, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- NDRG2 Picoband antibody, MBS177681, IHC(P)IHC(P): Rat Brain Tissue )

Related Product Information for anti-NDRG2 antibody

Description: Rabbit IgG polyclonal antibody for Protein NDRG2(NDRG2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Protein NDRG2, also known as KIAA1248, is a protein that in humans is encoded by the NDRG2 gene. It is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. This gene is mapped to 14q11.2. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. It contributes to the regulation of the WNT signaling pathway. Also, this gene may be involved in dendritic cell and neuron differentiation.

References

1. Kalaydjieva, L., Gresham, D., Gooding, R., Heather, L., Baas, F., de Jonge, R., Blechschmidt, K., Angelicheva, D., Chandler, D., Worsley, P., Rosenthal, A., King, R. H. M., Thomas, P. K. N-myc downstream-regulated gene 1 is mutated in hereditary motor and sensory neuropathy-Lom. Am. J. Hum. Genet. 67: 47-58, 2000. 2. Li, Y., Yang, J., Li, S., Zhang, J., Zheng, J., Hou, W., Zhao, H., Guo, Y., Liu, X., Dou, K., Situ, Z., Yao, L. N-myc downstream-regulated gene 2, a novel estrogen-targeted gene, is involved in the regulation of Na+/K(+)-ATPase. J. Biol. Chem. 286: 32289-32299, 2011.

NCBI and Uniprot Product Information

• NCBI GI #: 532524992
• NCBI GeneID: 57447
• NCBI Accession #: NP_001269140.1
• NCBI GenBank Nucleotide #: NM_001282211.1
• UniProt Accession #: Q9UN36; Q567T1; Q68DW2; Q86U08; Q86U46; Q96FD3; B3KUE3; B4DE86; B7WP11; B7WPD5; D3DS07; D3DS10
• Molecular Weight: 40,297 Da
• NCBI Official Full Name: protein NDRG2 isoform c
• NCBI Official Synonym Full Names: NDRG family member 2
• NCBI Official Symbol: NDRG2
• NCBI Official Synonym Symbols: SYLD
• NCBI Protein Information: protein NDRG2
• UniProt Protein Name: Protein NDRG2
• Protein Family: Protein
• UniProt Gene Name: NDRG2
• UniProt Synonym Gene Names: KIAA1248; SYLD
• UniProt Entry Name: NDRG2_HUMAN

NCBI Description

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

NDRG2: a pro-apoptotic protein that may be involved in dendritic cell and neuron differentiation. May have anti-tumor activity. Generally not expressed in tumor cell lines. Unlike Ndr1, Ndr2 and Ndr3 appear not to be controlled by N-myc or c-myc. The loss of NDRG2 expression has been shown to be a prognostic indicator in gastric carcinomas. Five isoforms of the human protein are produced by alternative splicing. Isoforms 1 and 2 are present in brain neurons and up-regulated in Alzheimer disease

Protein type: Apoptosis; Tumor suppressor

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: centrosome; cytoplasm; cytosol; Golgi apparatus; growth cone; microtubule organizing center; nucleoplasm; perinuclear region of cytoplasm

Molecular Function: protein binding

Biological Process: cell differentiation; negative regulation of cytokine production; negative regulation of smooth muscle cell proliferation; signal transduction; substantia nigra development; Wnt receptor signaling pathway