Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDFIP2 expression in transfected 293T cell line by NDFIP2 polyclonal antibody. Lane 1: NDFIP2 transfected lysate (26.62kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human NDFIP2 Polyclonal Antibody | anti-NDFIP2 antibody

NDFIP2 (NEDD4 Family-interacting Protein 2, NEDD4 WW Domain-binding Protein 5A, Putative MAPK-activating Protein PM04/PM05/PM06/PM07, Putative NF-kappa-B-activating Protein 413, KIAA1165, N4WBP5A, FLJ25842)

Gene Names
NDFIP2; N4WBP5A
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NDFIP2; Polyclonal Antibody; NDFIP2 (NEDD4 Family-interacting Protein 2; NEDD4 WW Domain-binding Protein 5A; Putative MAPK-activating Protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating Protein 413; KIAA1165; N4WBP5A; FLJ25842); Anti -NDFIP2 (NEDD4 Family-interacting Protein 2; anti-NDFIP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDFIP2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDHHQPGTGRYQVLLNEEDNSESSAIEQPPTSNPAPQIVQAVSSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL
Applicable Applications for anti-NDFIP2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NDFIP2, aa1-242 (AAH26126.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDFIP2 expression in transfected 293T cell line by NDFIP2 polyclonal antibody. Lane 1: NDFIP2 transfected lysate (26.62kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDFIP2 expression in transfected 293T cell line by NDFIP2 polyclonal antibody. Lane 1: NDFIP2 transfected lysate (26.62kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NDFIP2 antibody
Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. May modulate EGFR signaling.
Product Categories/Family for anti-NDFIP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,390 Da
NCBI Official Full Name
NEDD4 family-interacting protein 2 isoform 2
NCBI Official Synonym Full Names
Nedd4 family interacting protein 2
NCBI Official Symbol
NDFIP2
NCBI Official Synonym Symbols
N4WBP5A
NCBI Protein Information
NEDD4 family-interacting protein 2; NF-kappa-B-activating protein 413; NEDD4 WW domain-binding protein 5A; putative NF-kappa-B-activating protein 413; MAPK-activating protein PM04 PM05 PM06 PM07; putative MAPK-activating protein PM04/PM05/PM06/PM07
UniProt Protein Name
NEDD4 family-interacting protein 2
UniProt Gene Name
NDFIP2
UniProt Synonym Gene Names
KIAA1165; N4WBP5A
UniProt Entry Name
NFIP2_HUMAN

Uniprot Description

Function: Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. May modulate EGFR signaling. Ref.2 Ref.8 Ref.9

Subunit structure: Forms heterodimers with NDFIP1. Interacts with HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4. Interacts with NEDD4L

By similarity. Interacts with PTEN. When phosphorylated at Tyr-167, interacts with SRC and LYN SH2 domain. May thus act as a scaffold that recruits SRC to NDFIP1, enhancing NDFIP1 phosphorylation. Interacts with SLC11A2/DMT1. May interact with phosphorylated EGFR. Ref.1 Ref.7 Ref.9

Subcellular location: Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane. Endosome › multivesicular body membrane Ref.1 Ref.7 Ref.9.

Tissue specificity: Expressed in brain, lung, heart, skeletal muscle, kidney, liver and placenta. Ref.1

Induction: By T-cell activation. Ref.1

Domain: The PY (WW-binding) motifs are required for E3 ubiquitin-protein ligase activation and for ubiquitination.

Post-translational modification: Ubiquitinated by NEDD4 and ITCH. Also ubiquitinated by NEDD4L. Ubiquitination by NEDD4 or NEDD4L does not affect turnover

By similarity. Ref.8Undergoes transient tyrosine-phosphorylation following EGF stimulation, most probably catalyzed by SRC. Also phosphorylated by LYN and FYN. Ref.9

Sequence caution: The sequence AAH21988.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH26126.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA91863.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on NDFIP2

Similar Products

Product Notes

The NDFIP2 ndfip2 (Catalog #AAA646335) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDFIP2 (NEDD4 Family-interacting Protein 2, NEDD4 WW Domain-binding Protein 5A, Putative MAPK-activating Protein PM04/PM05/PM06/PM07, Putative NF-kappa-B-activating Protein 413, KIAA1165, N4WBP5A, FLJ25842) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDFIP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NDFIP2 ndfip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDHHQPGTGR YQVLLNEEDN SESSAIEQPP TSNPAPQIVQ AVSSAPALET DSSPPPYSSI TVEVPTTSDT EVYGEFYPVP PPYSVATSLP TYDEAEKAKA AAMAAAAAET SQRIQEEECP PRDDFSDADQ LRVGNDGIFM LAFFMAFIFN WLGFCLSFCI TNTIAGRYGA ICGFGLSLIK WILIVRFSDY FTGYFNGQYW LWWIFLVLGL LLFFRGFVNY LKVRNMSESM AAAHRTRYFF LL. It is sometimes possible for the material contained within the vial of "NDFIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.