Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NCR3 expression in transfected 293T cell line by NCR3 MaxPab polyclonal antibody.Lane 1: NCR3 transfected lysate(21.6 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human NCR3 Polyclonal Antibody | anti-NCR3 antibody

NCR3 (Natural Cytotoxicity Triggering Receptor 3, 1C7, CD337, LY117, MALS, NKp30) (Biotin)

Gene Names
NCR3; 1C7; MALS; CD337; LY117; NKp30
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
NCR3; Polyclonal Antibody; NCR3 (Natural Cytotoxicity Triggering Receptor 3; 1C7; CD337; LY117; MALS; NKp30) (Biotin); Natural Cytotoxicity Triggering Receptor 3; NKp30; anti-NCR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NCR3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NCR3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NCR3 (NP_667341.1, 1aa-201aa) full-length human protein.
Immunogen Sequence
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NCR3 expression in transfected 293T cell line by NCR3 MaxPab polyclonal antibody.Lane 1: NCR3 transfected lysate(21.6 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NCR3 expression in transfected 293T cell line by NCR3 MaxPab polyclonal antibody.Lane 1: NCR3 transfected lysate(21.6 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-NCR3 antibody
Natural cytotoxicity receptors (NCRs), such as NCR3, are activating natural killer (NK) cell receptors that belong to the immunoglobulin (Ig) superfamily. NCR3 is expressed in all resting and activated NK cells and forms a complex with CD3-zeta (CD3Z, or CD247; MIM 186780) (Sato et al., 2001 [PubMed 11782277]).[supplied by OMIM]
Product Categories/Family for anti-NCR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,393 Da
NCBI Official Full Name
natural cytotoxicity triggering receptor 3 isoform a
NCBI Official Synonym Full Names
natural cytotoxicity triggering receptor 3
NCBI Official Symbol
NCR3
NCBI Official Synonym Symbols
1C7; MALS; CD337; LY117; NKp30
NCBI Protein Information
natural cytotoxicity triggering receptor 3
UniProt Protein Name
Natural cytotoxicity triggering receptor 3
UniProt Gene Name
NCR3
UniProt Synonym Gene Names
1C7; LY117; NK-p30; NKp30
UniProt Entry Name
NCTR3_HUMAN

NCBI Description

The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2010]

Uniprot Description

NCR3: Cytotoxicity-activating receptor that contributes to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Engagement of NCR3 by BAG6 also promotes dendritic cell (DC) maturation, both through killing those DCs that did not properly acquire a mature phenotype, and inducing NK cells to release TNFA and IFNG, which promotes DC maturation. Belongs to the natural cytotoxicity receptor (NCR) family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: integral to plasma membrane

Biological Process: immune response; cell recognition; inflammatory response; positive regulation of natural killer cell mediated cytotoxicity

Disease: Malaria, Mild, Susceptibility To

Research Articles on NCR3

Similar Products

Product Notes

The NCR3 ncr3 (Catalog #AAA6451280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCR3 (Natural Cytotoxicity Triggering Receptor 3, 1C7, CD337, LY117, MALS, NKp30) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCR3 ncr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.