Western Blot (WB)
(WB Suggested Anti-NCR1 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Rabbit anti-Human NCR1 Polyclonal Antibody | anti-NCR1 antibody
NCR1 antibody - N-terminal region
Gene Names
NCR1; LY94; CD335; NKP46; NK-p46
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NCR1; Polyclonal Antibody; NCR1 antibody - N-terminal region; anti-NCR1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGE
Sequence Length
304
Applicable Applications for anti-NCR1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NCR1 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-NCR1 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Related Product Information for anti-NCR1 antibody
This is a rabbit polyclonal antibody against NCR1. It was validated on Western Blot
Target Description: NCR1 is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Target Description: NCR1 is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Product Categories/Family for anti-NCR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
natural cytotoxicity triggering receptor 1 isoform a
NCBI Official Synonym Full Names
natural cytotoxicity triggering receptor 1
NCBI Official Symbol
NCR1
NCBI Official Synonym Symbols
LY94; CD335; NKP46; NK-p46
NCBI Protein Information
natural cytotoxicity triggering receptor 1
UniProt Protein Name
Natural cytotoxicity triggering receptor 1
Protein Family
UniProt Gene Name
NCR1
UniProt Synonym Gene Names
LY94; NK-p46; NKp46; hNKp46
UniProt Entry Name
NCTR1_HUMAN
Uniprot Description
NCR1: Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Belongs to the natural cytotoxicity receptor (NCR) family. 6 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Apoptosis; Receptor, misc.
Chromosomal Location of Human Ortholog: 19q13.42
Cellular Component: SWI/SNF complex; integral to plasma membrane
Molecular Function: receptor signaling protein activity
Biological Process: regulation of natural killer cell mediated cytotoxicity; cellular defense response; natural killer cell activation; signal transduction
Research Articles on NCR1
Similar Products
Product Notes
The NCR1 ncr1 (Catalog #AAA3216126) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCR1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCR1 ncr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVEYQLHFEG SLFAVDRPKP PERINKVKFY IPDMNSRMAG QYSCIYRVGE. It is sometimes possible for the material contained within the vial of "NCR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
