Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in human liver.)

Rabbit anti-Human, Mouse NARS Polyclonal Antibody | anti-NARS antibody

NARS (Asparagine-tRNA Ligase, Cytoplasmic, Asparaginyl-tRNA Synthetase, AsnRS) (Biotin)

Gene Names
NARS; ASNRS; NARS1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NARS; Polyclonal Antibody; NARS (Asparagine-tRNA Ligase; Cytoplasmic; Asparaginyl-tRNA Synthetase; AsnRS) (Biotin); anti-NARS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NARS. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NARS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NARS, aa1-548 (NP_004530.1).
Immunogen Sequence
MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in human liver.)

Western Blot (WB) (NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in human liver.)

Western Blot (WB)

(NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in mouse spleen.)

Western Blot (WB) (NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in mouse spleen.)

Western Blot (WB)

(NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in HeLa.)

Western Blot (WB) (NARS rabbit polyclonal antibody. Western Blot analysis of NARS expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of NARS expression in transfected 293T cell line by NARS polyclonal antibody. Lane 1: NARS transfected lysate (62.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NARS expression in transfected 293T cell line by NARS polyclonal antibody. Lane 1: NARS transfected lysate (62.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NARS antibody
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases.
Product Categories/Family for anti-NARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,033 Da
NCBI Official Full Name
asparagine--tRNA ligase, cytoplasmic
NCBI Official Synonym Full Names
asparaginyl-tRNA synthetase
NCBI Official Symbol
NARS
NCBI Official Synonym Symbols
ASNRS; NARS1
NCBI Protein Information
asparagine--tRNA ligase, cytoplasmic; asparagine tRNA ligase 1, cytoplasmic; asparaginyl-tRNA synthetase, cytoplasmic
UniProt Protein Name
Asparagine--tRNA ligase, cytoplasmic
UniProt Gene Name
NARS
UniProt Synonym Gene Names
AsnRS
UniProt Entry Name
SYNC_HUMAN

Uniprot Description

NARS: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases. [provided by RefSeq, Jul 2008]

Protein type: Translation; EC 6.1.1.22; Ligase

Chromosomal Location of Human Ortholog: 18q21.31

Cellular Component: mitochondrion; cytoplasm; cytosol

Molecular Function: nucleic acid binding; asparagine-tRNA ligase activity; ATP binding

Biological Process: asparaginyl-tRNA aminoacylation; tRNA aminoacylation for protein translation; gene expression

Similar Products

Product Notes

The NARS nars (Catalog #AAA6386492) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NARS (Asparagine-tRNA Ligase, Cytoplasmic, Asparaginyl-tRNA Synthetase, AsnRS) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NARS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NARS nars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NARS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.