Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CTSG AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit CTSG Polyclonal Antibody | anti-CTSG antibody

CTSG antibody - C-terminal region

Gene Names
CTSG; CG; CATG
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTSG; Polyclonal Antibody; CTSG antibody - C-terminal region; anti-CTSG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEV
Sequence Length
255
Applicable Applications for anti-CTSG antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CTSG AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CTSG AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-CTSG antibody
This is a rabbit polyclonal antibody against CTSG. It was validated on Western Blot

Target Description: The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. Transcript variants utilizing alternative polyadenylation signals exist for this gene.
Product Categories/Family for anti-CTSG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
cathepsin G preproprotein
NCBI Official Synonym Full Names
cathepsin G
NCBI Official Symbol
CTSG
NCBI Official Synonym Symbols
CG; CATG
NCBI Protein Information
cathepsin G
UniProt Protein Name
Cathepsin G
Protein Family
UniProt Gene Name
CTSG
UniProt Synonym Gene Names
CG
UniProt Entry Name
CATG_HUMAN

NCBI Description

The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

CTSG: Serine protease with trypsin- and chymotrypsin-like specificity. Cleaves complement C3. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa, antibacterial activity is inhibited by LPS from P.aeruginosa, Z-Gly-Leu-Phe- CH2Cl and phenylmethylsulfonyl fluoride. Belongs to the peptidase S1 family.

Protein type: Motility/polarity/chemotaxis; EC 3.4.21.20; Protease

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: extracellular matrix; extracellular space; cell surface; plasma membrane; extracellular region; nucleus; secretory granule

Molecular Function: heparin binding; peptidase activity; serine-type endopeptidase activity

Biological Process: extracellular matrix disassembly; positive regulation of immune response; extracellular matrix organization and biogenesis; cellular protein metabolic process; immune response; response to lipopolysaccharide; protein processing; proteolysis; angiotensin maturation; defense response to fungus

Research Articles on CTSG

Similar Products

Product Notes

The CTSG ctsg (Catalog #AAA3215093) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTSG antibody - C-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTSG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTSG ctsg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SYDPRRQICV GDRRERKAAF KGDSGGPLLC NNVAHGIVSY GKSSGVPPEV. It is sometimes possible for the material contained within the vial of "CTSG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.