Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit NAPA Polyclonal Antibody | anti-NAPA antibody

NAPA antibody - N-terminal region

Gene Names
NAPA; SNAPA
Reactivity
Cow, Dog, Mouse, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
NAPA; Polyclonal Antibody; NAPA antibody - N-terminal region; anti-NAPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Mouse, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN
Sequence Length
295
Applicable Applications for anti-NAPA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Mouse: 78%; Zebrafish: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NAPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-NAPA antibody
This is a rabbit polyclonal antibody against NAPA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The 'SNARE hypothesis' is a model explaining the process of docking and fusion of vesicles to their target membranes. According to this model, membrane proteins from the vesicle (v-SNAREs) and proteins from the target membrane (t-SNAREs) govern the specificity of vesicle targeting and docking through mutual recognition. Once the 2 classes of SNAREs bind to each other, they form a complex that recruits the general elements of the fusion apparatus, namely NSF (N-ethylmaleimide-sensitive factor) and SNAPs (soluble NSF-attachment proteins), to the site of membrane fusion, thereby forming the 20S fusion complex. Alpha- and gamma-SNAP are found in a wide range of tissues and act synergistically in intra-Golgi transport. The sequence of the predicted 295-amino acid human protein encoded by NAPA shares 37%, 60%, and 67% identity with the sequences of yeast, Drosophila, and squid alpha-SNAP, respectively.
Product Categories/Family for anti-NAPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
alpha-soluble NSF attachment protein
NCBI Official Synonym Full Names
NSF attachment protein alpha
NCBI Official Symbol
NAPA
NCBI Official Synonym Symbols
SNAPA
NCBI Protein Information
alpha-soluble NSF attachment protein
UniProt Protein Name
Alpha-soluble NSF attachment protein
Protein Family
UniProt Gene Name
NAPA
UniProt Synonym Gene Names
SNAPA; SNAP-alpha
UniProt Entry Name
SNAA_HUMAN

NCBI Description

This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

SNAP-alpha: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Belongs to the SNAP family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: SNARE complex; membrane; vacuolar membrane; cytosol

Molecular Function: protein binding; syntaxin binding; soluble NSF attachment protein activity

Biological Process: neuron differentiation; synaptic transmission, glutamatergic; intracellular protein transport; intra-Golgi vesicle-mediated transport; apical protein localization; brain development; post-Golgi vesicle-mediated transport

Research Articles on NAPA

Similar Products

Product Notes

The NAPA napa (Catalog #AAA3224503) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAPA antibody - N-terminal region reacts with Cow, Dog, Mouse, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NAPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAPA napa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDNSGKEAEA MALLAEAERK VKNSQSFFSG LFGGSSKIEE ACEIYARAAN. It is sometimes possible for the material contained within the vial of "NAPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.