Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-NAIP Polyclonal Antibody)

Rabbit anti-Rat NAIP Polyclonal Antibody | anti-NAIP antibody

NAIP Polyclonal Antibody

Gene Names
NAIP; BIRC1; NLRB1; psiNAIP
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NAIP; Polyclonal Antibody; NAIP Polyclonal Antibody; BIRC1; NLRB1; psiNAIP; NLR family apoptosis inhibitory protein; anti-NAIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.57 mg/ml (varies by lot)
Sequence Length
1347
Applicable Applications for anti-NAIP antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 750-850 of human NAIP (NP_075043.1).
Immunogen Sequence
LLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVV
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-NAIP Polyclonal Antibody)

Western Blot (WB) (Western blot-NAIP Polyclonal Antibody)
Related Product Information for anti-NAIP antibody
This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternative splicing and the use of alternative promoters results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
NAIP protein
NCBI Official Synonym Full Names
NLR family apoptosis inhibitory protein
NCBI Official Symbol
NAIP
NCBI Official Synonym Symbols
BIRC1; NLRB1; psiNAIP
NCBI Protein Information
baculoviral IAP repeat-containing protein 1
UniProt Protein Name
Baculoviral IAP repeat-containing protein 1
UniProt Gene Name
NAIP
UniProt Synonym Gene Names
BIRC1
UniProt Entry Name
BIRC1_HUMAN

NCBI Description

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016]

Uniprot Description

BIRC1: Anti-apoptotic protein which acts by inhibiting the activities of CASP3, CASP7 and CASP9. Can inhibit the autocleavage of pro-CASP9 and cleavage of pro-CASP3 by CASP9. Capable of inhibiting CASP9 autoproteolysis at 'Asp-315' and decreasing the rate of auto proteolysis at 'Asp-330'. Acts as a mediator of neuronal survival in pathological conditions. Prevents motor- neuron apoptosis induced by a variety of signals. Possible role in the prevention of spinal muscular atrophy that seems to be caused by inappropriate persistence of motor-neuron apoptosis: mutated or deleted forms of NAIP have been found in individuals with severe spinal muscular atrophy.

Chromosomal Location of Human Ortholog: 5q13.2

Cellular Component: basolateral plasma membrane; spindle microtubule; cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; caspase inhibitor activity; ubiquitin-protein ligase activity; ATP binding

Biological Process: nervous system development; regulation of signal transduction; innate immune response; protein ubiquitination; negative regulation of caspase activity; negative regulation of neuron apoptosis; inflammatory response; negative regulation of apoptosis

Research Articles on NAIP

Similar Products

Product Notes

The NAIP naip (Catalog #AAA9141008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAIP Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NAIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NAIP naip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.