Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NAB2 expression in transfected 293T cell line by NAB2 MaxPab polyclonal antibody.Lane 1: NAB2 transfected lysate(25.90 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human NAB2 Polyclonal Antibody | anti-NAB2 antibody

NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2), MADER, MGC75085) (FITC)

Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
NAB2; Polyclonal Antibody; NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2); MADER; MGC75085) (FITC); NGFI-A Binding Protein 2 (EGR1 Binding Protein 2); MGC75085; anti-NAB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NAB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-NAB2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NAB2 (AAH07756.1, 1aa-241aa) full-length human protein.
Immunogen Sequence
MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(Western Blot analysis of NAB2 expression in transfected 293T cell line by NAB2 MaxPab polyclonal antibody.Lane 1: NAB2 transfected lysate(25.90 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NAB2 expression in transfected 293T cell line by NAB2 MaxPab polyclonal antibody.Lane 1: NAB2 transfected lysate(25.90 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-NAB2 antibody
This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo-or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]
Product Categories/Family for anti-NAB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
Protein Family

Similar Products

Product Notes

The NAB2 (Catalog #AAA6451259) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAB2 (NGFI-A Binding Protein 2 (EGR1 Binding Protein 2), MADER, MGC75085) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.