Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Mouse anti-Human NAB2 Monoclonal Antibody | anti-NAB2 antibody

NAB2 (NGFI-A Binding Protein 2, EGR-1-binding Protein 2, Melanoma-associated Delayed Early Response Protein, MADER, Protein MADER, MGC75085, MGC75085) (AP)

Gene Names
NAB2; MADER
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAB2; Monoclonal Antibody; NAB2 (NGFI-A Binding Protein 2; EGR-1-binding Protein 2; Melanoma-associated Delayed Early Response Protein; MADER; Protein MADER; MGC75085; MGC75085) (AP); anti-NAB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Specificity
Recognizes human NAB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NAB2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa421-525 from human NAB2 (NP_005958) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Testing Data

(Detection limit for recombinant GST tagged NAB2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NAB2 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-NAB2 antibody
NAB2 is a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by this protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex.
Product Categories/Family for anti-NAB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,748 Da
NCBI Official Full Name
NGFI-A-binding protein 2
NCBI Official Synonym Full Names
NGFI-A binding protein 2 (EGR1 binding protein 2)
NCBI Official Symbol
NAB2
NCBI Official Synonym Symbols
MADER
NCBI Protein Information
NGFI-A-binding protein 2; EGR-1-binding protein 2; EGR1 binding protein 2; melanoma-associated delayed early response protein
UniProt Protein Name
NGFI-A-binding protein 2
Protein Family
UniProt Gene Name
NAB2
UniProt Synonym Gene Names
MADER; Protein MADER
UniProt Entry Name
NAB2_HUMAN

Uniprot Description

NAB2: Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability. Belongs to the NAB family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus

Molecular Function: transcription factor binding; transcription corepressor activity

Biological Process: Schwann cell differentiation; myelination; cell proliferation; nervous system development; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase III promoter; regulation of epidermis development; endochondral ossification

Similar Products

Product Notes

The NAB2 nab2 (Catalog #AAA6132475) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAB2 (NGFI-A Binding Protein 2, EGR-1-binding Protein 2, Melanoma-associated Delayed Early Response Protein, MADER, Protein MADER, MGC75085, MGC75085) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAB2 nab2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.