Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human, Yeast NAA80 Polyclonal Antibody | anti-NAA80 antibody

NAA80 Antibody - C-terminal region

Gene Names
NAA80; FUS2; NAT6; FUS-2; HsNAAA80
Reactivity
Human, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NAA80; Polyclonal Antibody; NAA80 Antibody - C-terminal region; anti-NAA80 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP
Sequence Length
308
Applicable Applications for anti-NAA80 antibody
Western Blot (WB)
Homology
Human: 100%; Yeast: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NAT6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NAA80 antibody
This is a rabbit polyclonal antibody against NAT6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon.
Product Categories/Family for anti-NAA80 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
N-alpha-acetyltransferase 80 isoform 1
NCBI Official Synonym Full Names
N(alpha)-acetyltransferase 80, NatH catalytic subunit
NCBI Official Symbol
NAA80
NCBI Official Synonym Symbols
FUS2; NAT6; FUS-2; HsNAAA80
NCBI Protein Information
N-alpha-acetyltransferase 80
UniProt Protein Name
N-acetyltransferase 6
UniProt Gene Name
NAT6
UniProt Synonym Gene Names
FUS2; Protein fus-2
UniProt Entry Name
NAT6_HUMAN

NCBI Description

This gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon. [provided by RefSeq, Jan 2011]

Uniprot Description

NAT6: Seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. May act as a tumor suppressor. Belongs to the acetyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - glycerophospholipid; Tumor suppressor; Acetyltransferase; Amino Acid Metabolism - phenylalanine; EC 2.3.1.-; Secondary Metabolites Metabolism - limonene and pinene degradation; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: cytoplasm

Molecular Function: N-acetyltransferase activity

Biological Process: metabolic process

Research Articles on NAA80

Similar Products

Product Notes

The NAA80 nat6 (Catalog #AAA3209143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAA80 Antibody - C-terminal region reacts with Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's NAA80 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAA80 nat6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYQLGEPVQG LVFTSRRLPA TLLNAFPTAP SPRPPRKAPN LTAQAAPRGP. It is sometimes possible for the material contained within the vial of "NAA80, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.