Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYOZ1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MYOZ1 Polyclonal Antibody | anti-MYOZ1 antibody

MYOZ1 Antibody - middle region

Gene Names
MYOZ1; CS-2; FATZ; MYOZ
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MYOZ1; Polyclonal Antibody; MYOZ1 Antibody - middle region; anti-MYOZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQ
Sequence Length
299
Applicable Applications for anti-MYOZ1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MYOZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYOZ1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYOZ1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MYOZ1 antibody
The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
myozenin-1
NCBI Official Synonym Full Names
myozenin 1
NCBI Official Symbol
MYOZ1
NCBI Official Synonym Symbols
CS-2; FATZ; MYOZ
NCBI Protein Information
myozenin-1
UniProt Protein Name
Myozenin-1
Protein Family
UniProt Gene Name
MYOZ1
UniProt Entry Name
MYOZ1_HUMAN

NCBI Description

The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]

Uniprot Description

MYOZ1: Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma- filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis. Belongs to the myozenin family.

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: pseudopodium; nucleus; actin cytoskeleton

Molecular Function: protein binding; FATZ binding

Biological Process: myofibril assembly

Research Articles on MYOZ1

Similar Products

Product Notes

The MYOZ1 myoz1 (Catalog #AAA3223451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYOZ1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYOZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYOZ1 myoz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVFSDSSMDH FQKFLPTVGG QLGTAGQGFS YSKSNGRGGS QAGGSGSAGQ. It is sometimes possible for the material contained within the vial of "MYOZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.