Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYO5ASample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human MYO5A Polyclonal Antibody | anti-MYO5A antibody

MYO5A Antibody - Middle region

Gene Names
MYO5A; GS1; MYO5; MYH12; MYR12
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MYO5A; Polyclonal Antibody; MYO5A Antibody - Middle region; anti-MYO5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL
Sequence Length
1828
Applicable Applications for anti-MYO5A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the Middle region of Human MYO5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYO5ASample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYO5ASample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: MYO5ASample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYO5ASample Type: 721_B Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYO5A antibody
This is a rabbit polyclonal antibody against MYO5A. It was validated on Western Blot

Target Description: This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
201 kDa
NCBI Official Full Name
unconventional myosin-Va isoform 1
NCBI Official Synonym Full Names
myosin VA
NCBI Official Symbol
MYO5A
NCBI Official Synonym Symbols
GS1; MYO5; MYH12; MYR12
NCBI Protein Information
unconventional myosin-Va
UniProt Protein Name
Unconventional myosin-Va
Protein Family
UniProt Gene Name
MYO5A
UniProt Synonym Gene Names
MYH12
UniProt Entry Name
MYO5A_HUMAN

NCBI Description

This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined. [provided by RefSeq, Dec 2008]

Uniprot Description

MYO5A: Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. Involved in melanosome transport. May also be required for some polarization process involved in dendrite formation. May be a homodimer, which associates with multiple calmodulin or myosin light chains. Binds MLPH and MYRIP. Interacts with RIPL2, the interaction is required for its role in dendrite formation. Detected in melanocytes. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Motor

Chromosomal Location of Human Ortholog: 15q21

Cellular Component: Golgi apparatus; filopodium tip; neuron projection; lysosome; endoplasmic reticulum; early endosome; intermediate filament; actomyosin; actin filament; cytosol; ruffle; recycling endosome; photoreceptor outer segment; growth cone; cell soma; membrane; late endosome; cytoplasm; melanosome; peroxisome; myosin complex; vesicle

Molecular Function: microfilament motor activity; calmodulin binding; calcium ion binding; actin binding; Rab GTPase binding; ATP binding

Biological Process: myelination; exocytosis; ER localization; actin filament-based movement; long-chain fatty acid biosynthetic process; melanosome transport; locomotion during locomotory behavior; odontogenesis; vesicle-mediated transport; melanin biosynthetic process; vesicle transport along actin filament; synaptic transmission; cellular protein metabolic process; cellular response to insulin stimulus; visual perception; insulin secretion; transport; melanocyte differentiation; synapse organization and biogenesis; regulation of inositol-1,4,5-triphosphate receptor activity; post-Golgi vesicle-mediated transport; secretory granule localization

Disease: Griscelli Syndrome, Type 1

Research Articles on MYO5A

Similar Products

Product Notes

The MYO5A myo5a (Catalog #AAA3219526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYO5A Antibody - Middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYO5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYO5A myo5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMVHVPKPGH KRTDSTHSSN ESEYIFSSEI AEMEDIPSRT EEPSEKKVPL. It is sometimes possible for the material contained within the vial of "MYO5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.