Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MYLIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SK-MEL-2 cell lysate)

Rabbit MYLIP Polyclonal Antibody | anti-MYLIP antibody

MYLIP antibody - middle region

Gene Names
MYLIP; MIR; IDOL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYLIP; Polyclonal Antibody; MYLIP antibody - middle region; anti-MYLIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE
Sequence Length
445
Applicable Applications for anti-MYLIP antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MYLIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MYLIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SK-MEL-2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MYLIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SK-MEL-2 cell lysate)
Related Product Information for anti-MYLIP antibody
This is a rabbit polyclonal antibody against MYLIP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowthThe ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.
Product Categories/Family for anti-MYLIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MYLIP
NCBI Official Synonym Full Names
myosin regulatory light chain interacting protein
NCBI Official Symbol
MYLIP
NCBI Official Synonym Symbols
MIR; IDOL
NCBI Protein Information
E3 ubiquitin-protein ligase MYLIP
UniProt Protein Name
E3 ubiquitin-protein ligase MYLIP
UniProt Gene Name
MYLIP
UniProt Synonym Gene Names
BZF1; IDOL; Idol; MIR
UniProt Entry Name
MYLIP_HUMAN

NCBI Description

The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth. [provided by RefSeq, Jul 2008]

Uniprot Description

MYLIP: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of myosin regulatory light chain (MRLC), LDLR, VLDLR and LRP8. Activity depends on E2 enzymes of the UBE2D family. Proteasomal degradation of MRLC leads to inhibit neurite outgrowth in presence of NGF by counteracting the stabilization of MRLC by saposin-like protein (CNPY2/MSAP) and reducing CNPY2-stimulated neurite outgrowth. Acts as a sterol- dependent inhibitor of cellular cholesterol uptake by mediating ubiquitination and subsequent degradation of LDLR. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Ubiquitin ligase; EC 6.3.2.19; EC 6.3.2.-; Motility/polarity/chemotaxis; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: extrinsic to membrane; cytoskeleton; cytoplasm; plasma membrane; intracellular

Molecular Function: protein binding; zinc ion binding; cytoskeletal protein binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: nervous system development; cholesterol homeostasis; protein destabilization; protein ubiquitination during ubiquitin-dependent protein catabolic process; positive regulation of protein catabolic process; protein ubiquitination; regulation of low-density lipoprotein receptor catabolic process; cell motility

Research Articles on MYLIP

Similar Products

Product Notes

The MYLIP mylip (Catalog #AAA3206728) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYLIP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYLIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYLIP mylip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSSCEGLSCQ QTRVLQEKLR KLKEAMLCMV CCEEEINSTF CPCGHTVCCE. It is sometimes possible for the material contained within the vial of "MYLIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.