Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYL12ASample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MYL12A Polyclonal Antibody | anti-MYL12A antibody

MYL12A Antibody - N-terminal region

Gene Names
MYL12A; MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MYL12A; Polyclonal Antibody; MYL12A Antibody - N-terminal region; anti-MYL12A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDK
Sequence Length
171
Applicable Applications for anti-MYL12A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MYL12A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYL12ASample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYL12ASample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MYL12A antibody
This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.
Product Categories/Family for anti-MYL12A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
myosin regulatory light chain 12A isoform 1
NCBI Official Synonym Full Names
myosin light chain 12A
NCBI Official Symbol
MYL12A
NCBI Official Synonym Symbols
MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24
NCBI Protein Information
myosin regulatory light chain 12A
UniProt Protein Name
Myosin regulatory light chain 12A
Protein Family
UniProt Gene Name
MYL12A
UniProt Synonym Gene Names
MLCB; MRLC3; RLC; HEL-S-24
UniProt Entry Name
ML12A_HUMAN

NCBI Description

This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014]

Uniprot Description

MRLC3: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. Myosin is an hexamer of 2 heavy chains and 4 light chains.

Protein type: Contractile

Chromosomal Location of Human Ortholog: 18p11.31

Cellular Component: myosin II complex; stress fiber; cytosol; Z disc

Molecular Function: protein binding; glutamate receptor binding; calcium ion binding

Biological Process: axon guidance; regulation of cell shape; ephrin receptor signaling pathway

Similar Products

Product Notes

The MYL12A myl12a (Catalog #AAA3220995) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYL12A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYL12A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYL12A myl12a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSKRTKTKT KKRPQRATSN VFAMFDQSQI QEFKEAFNMI DQNRDGFIDK. It is sometimes possible for the material contained within the vial of "MYL12A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.