Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Mouse testis, using MYF5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Mouse MYF5 Polyclonal Antibody | anti-MYF5 antibody

MYF5 Rabbit pAb

Gene Names
MYF5; bHLHc2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
MYF5; Polyclonal Antibody; MYF5 Rabbit pAb; bHLHc2; anti-MYF5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL
Applicable Applications for anti-MYF5 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human MYF5 (NP_005584.2).
Positive Samples
Mouse testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Mouse testis, using MYF5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of Mouse testis, using MYF5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,296 Da
NCBI Official Full Name
myogenic factor 5
NCBI Official Synonym Full Names
myogenic factor 5
NCBI Official Symbol
MYF5
NCBI Official Synonym Symbols
bHLHc2
NCBI Protein Information
myogenic factor 5; myf-5; class C basic helix-loop-helix protein 2
UniProt Protein Name
Myogenic factor 5
Protein Family
UniProt Gene Name
MYF5
UniProt Synonym Gene Names
BHLHC2; Myf-5; bHLHc2
UniProt Entry Name
MYF5_HUMAN

Uniprot Description

Myf-5: Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q21

Cellular Component: nucleoplasm

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein heterodimerization activity

Biological Process: transcription from RNA polymerase II promoter; ossification; extracellular matrix organization and biogenesis; muscle development; skeletal muscle development; somitogenesis; camera-type eye development; regulation of cell-matrix adhesion; muscle cell fate commitment; positive regulation of myoblast differentiation; embryonic skeletal morphogenesis; regulation of transcription from RNA polymerase II promoter; muscle cell differentiation; positive regulation of skeletal muscle fiber development; positive regulation of muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; cartilage condensation

Research Articles on MYF5

Similar Products

Product Notes

The MYF5 myf5 (Catalog #AAA9142229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYF5 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MYF5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MYF5 myf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDVMDGCQFS PSEYFYDGSC IPSPEGEFGD EFVPRVAAFG AHKAELQGSD EDEHVRAPTG HHQAGHCLMW ACKACKRKST TMDRRKAATM RERRRLKKVN QAFETLKRCT TTNPNQRLPK VEILRNAIRY IESLQELLRE QVENYYSLPG QSCSEPTSPT SNCSDGMPEC NSPVWSRKSS TFDSIYCPDV SNVYATDKNS LSSLDCLSNI VDRITSSEQP GLPLQDLASL SPVASTDSQP ATPGASSSRL IYHVL. It is sometimes possible for the material contained within the vial of "MYF5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.