Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-MYC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit MYC Polyclonal Antibody | anti-MYC antibody

MYC antibody - N-terminal region

Gene Names
MYC; MRTL; MYCC; c-Myc; bHLHe39
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYC; Polyclonal Antibody; MYC antibody - N-terminal region; anti-MYC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGL
Sequence Length
454
Applicable Applications for anti-MYC antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MYC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-MYC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-MYC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MYC antibody
This is a rabbit polyclonal antibody against MYC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
myc proto-oncogene protein isoform 1
NCBI Official Synonym Full Names
MYC proto-oncogene, bHLH transcription factor
NCBI Official Symbol
MYC
NCBI Official Synonym Symbols
MRTL; MYCC; c-Myc; bHLHe39
NCBI Protein Information
myc proto-oncogene protein
UniProt Protein Name
Myc proto-oncogene protein
Protein Family
UniProt Gene Name
MYC
UniProt Synonym Gene Names
BHLHE39; bHLHe39
UniProt Entry Name
MYC_HUMAN

NCBI Description

This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017]

Uniprot Description

Myc: a proto-oncogenic transcription factor that plays a role in cell proliferation, apoptosis and in the development of human tumors. Seems to activate the transcription of growth-related genes.

Protein type: DNA-binding; Transcription factor; Oncoprotein; Nucleolus

Chromosomal Location of Human Ortholog: 8q24.21

Cellular Component: nucleoplasm; protein complex; nucleolus; nucleus; cytosol

Molecular Function: protein dimerization activity; protein binding; DNA binding; protein complex binding; transcription factor activity; transcription factor binding

Biological Process: oxygen transport; cellular iron ion homeostasis; positive regulation of transcription, DNA-dependent; positive regulation of caspase activity; Wnt receptor signaling pathway through beta-catenin; negative regulation of transcription from RNA polymerase II promoter; chromosome organization and biogenesis; positive regulation of fibroblast proliferation; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; response to gamma radiation; cell cycle arrest; response to drug; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; transcription, DNA-dependent; regulation of telomere maintenance; MAPKKK cascade; negative regulation of cell division; negative regulation of stress-activated MAPK cascade; negative regulation of monocyte differentiation; chromatin remodeling; ureteric bud branching; negative regulation of fibroblast proliferation; regulation of gene expression; energy reserve metabolic process; positive regulation of transcription from RNA polymerase II promoter; gene expression; response to DNA damage stimulus; positive regulation of epithelial cell proliferation; negative regulation of apoptosis

Disease: Burkitt Lymphoma

Research Articles on MYC

Similar Products

Product Notes

The MYC myc (Catalog #AAA3200207) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYC antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MYC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYC myc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPYFYCDEEE NFYQQQQQSE LQPPAPSEDI WKKFELLPTP PLSPSRRSGL. It is sometimes possible for the material contained within the vial of "MYC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.