Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MUTED AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit MUTED Polyclonal Antibody | anti-BLOC1S5 antibody

MUTED Antibody - C-terminal region

Gene Names
BLOC1S5; MU; BLOS5; MUTED
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MUTED; Polyclonal Antibody; MUTED Antibody - C-terminal region; anti-BLOC1S5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKE
Sequence Length
187
Applicable Applications for anti-BLOC1S5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of MUTED
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MUTED AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-MUTED AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-BLOC1S5 antibody
This is a rabbit polyclonal antibody against MUTED. It was validated on Western Blot

Target Description: This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Alternative splicing results in multiple transcript variants. Read-through transcription exists between this gene and the upstream EEF1E1 (eukaryotic translation elongation factor 1 epsilon 1) gene, as well as with the downstream TXNDC5 (thioredoxin domain containing 5) gene.
Product Categories/Family for anti-BLOC1S5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
biogenesis of lysosome-related organelles complex 1 subunit 5 isoform 1
NCBI Official Synonym Full Names
biogenesis of lysosomal organelles complex 1 subunit 5
NCBI Official Symbol
BLOC1S5
NCBI Official Synonym Symbols
MU; BLOS5; MUTED
NCBI Protein Information
biogenesis of lysosome-related organelles complex 1 subunit 5
UniProt Protein Name
Biogenesis of lysosome-related organelles complex 1 subunit 5
UniProt Gene Name
BLOC1S5
UniProt Synonym Gene Names
MUTED; BLOC-1 subunit 5
UniProt Entry Name
BL1S5_HUMAN

NCBI Description

This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Alternative splicing results in multiple transcript variants. Read-through transcription exists between this gene and the upstream EEF1E1 (eukaryotic translation elongation factor 1 epsilon 1) gene, as well as with the downstream TXNDC5 (thioredoxin domain containing 5) gene. [provided by RefSeq, Dec 2010]

Uniprot Description

MUTED: The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. Plays a role in intracellular vesicle trafficking. Belongs to the Muted family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 6p25.1-p24.3

Cellular Component: transport vesicle

Molecular Function: protein binding

Biological Process: positive regulation of pigment cell differentiation; melanosome organization and biogenesis; otolith morphogenesis; anterograde synaptic vesicle transport; anterograde axon cargo transport; melanosome transport; neurite development

Research Articles on BLOC1S5

Similar Products

Product Notes

The BLOC1S5 bloc1s5 (Catalog #AAA3215957) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUTED Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MUTED can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BLOC1S5 bloc1s5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSQVLQRLQA ANDSVCRLQQ REQERKKIHS DHLVASEKQH MLQWDNFMKE. It is sometimes possible for the material contained within the vial of "MUTED, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.