Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-MUC20 Polyclonal Antibody)

Rabbit MUC20 Polyclonal Antibody | anti-MUC20 antibody

MUC20 Polyclonal Antibody

Gene Names
MUC20; MUC-20
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
MUC20; Polyclonal Antibody; MUC20 Polyclonal Antibody; MUC-20; mucin-20; anti-MUC20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.72 mg/ml (varies by lot)
Sequence Length
709
Applicable Applications for anti-MUC20 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3).
Immunogen Sequence
PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD
Positive Samples
293T, A-549, DU145, LO2, U-251MG, HT-29, Mouse Kidney, Mouse Lung, Rat Kidney
Cellular Location
Apical Cell Membrane, Basolateral Cell Membrane, Cell Projection, Secreted, Microvillus Membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-MUC20 Polyclonal Antibody)

Western Blot (WB) (Western blot-MUC20 Polyclonal Antibody)
Related Product Information for anti-MUC20 antibody
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins secreted by many epithelial tissues to form an insoluble mucous barrier. The C-terminus of this family member associates with the multifunctional docking site of the MET proto-oncogene and suppresses activation of some downstream MET signaling cascades. The protein features a mucin tandem repeat domain that varies between two and six copies in most individuals. Multiple variants encoding different isoforms have been found for this gene. A related pseudogene, which is also located on chromosome 3, has been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 68kDa; 71kDa
Observed: 80kDa
NCBI Official Full Name
Mucin-20
NCBI Official Synonym Full Names
mucin 20, cell surface associated
NCBI Official Symbol
MUC20
NCBI Official Synonym Symbols
MUC-20
NCBI Protein Information
mucin-20
UniProt Protein Name
Mucin-20
Protein Family
UniProt Gene Name
MUC20
UniProt Synonym Gene Names
KIAA1359; MUC-20
UniProt Entry Name
MUC20_HUMAN

NCBI Description

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins secreted by many epithelial tissues to form an insoluble mucous barrier. The C-terminus of this family member associates with the multifunctional docking site of the MET proto-oncogene and suppresses activation of some downstream MET signaling cascades. The protein features a mucin tandem repeat domain that varies between two and six copies in most individuals. Multiple variants encoding different isoforms have been found for this gene. A related pseudogene, which is also located on chromosome 3, has been identified. [provided by RefSeq, Apr 2014]

Uniprot Description

MUC20: May regulate MET signaling cascade. Seems to decrease hepatocyte growth factor (HGF)-induced transient MAPK activation. Blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway. Inhibits HGF-induced proliferation of MMP1 and MMP9 expression. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: Golgi lumen; microvillus membrane; apical plasma membrane; basal plasma membrane; extracellular region

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; activation of MAPK activity; hepatocyte growth factor receptor signaling pathway; post-translational protein modification; protein homooligomerization

Research Articles on MUC20

Similar Products

Product Notes

The MUC20 muc20 (Catalog #AAA9140658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUC20 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MUC20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the MUC20 muc20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MUC20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.