Western Blot (WB)
(MTP18 polyclonal antibody. Western Blot analysis of MTP18 expression in human liver.)
Mouse anti-Human MTP18 Polyclonal Antibody | anti-MTFP1 antibody
MTP18 (Myotubularin-related Protein 6 MTFP1, Mitochondrial Fission Process Protein 1, Mitochondrial 18 kDa Protein, HSPC242, My022)
Gene Names
MTFP1; MTP18; HSPC242
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MTP18; Polyclonal Antibody; MTP18 (Myotubularin-related Protein 6 MTFP1; Mitochondrial Fission Process Protein 1; Mitochondrial 18 kDa Protein; HSPC242; My022); Anti -MTP18 (Myotubularin-related Protein 6 MTFP1; anti-MTFP1 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MTP18.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
Applicable Applications for anti-MTFP1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MTP18, aa1-166 (NP_057582.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(MTP18 polyclonal antibody. Western Blot analysis of MTP18 expression in human liver.)
Western Blot (WB)
(MTP18 polyclonal antibody. Western Blot analysis of MTP18 expression in human liver.)
Western Blot (WB)
(Western Blot analysis of MTP18 expression in transfected 293T cell line by MTP18 polyclonal antibody. Lane 1: MTP18 transfected lysate (18.26kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MTP18 expression in transfected 293T cell line by MTP18 polyclonal antibody. Lane 1: MTP18 transfected lysate (18.26kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MTFP1 antibody
Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis.
Product Categories/Family for anti-MTFP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,010 Da
NCBI Official Full Name
mitochondrial fission process protein 1 isoform b
NCBI Official Synonym Full Names
mitochondrial fission process 1
NCBI Official Symbol
MTFP1
NCBI Official Synonym Symbols
MTP18; HSPC242
NCBI Protein Information
mitochondrial fission process protein 1; mitochondrial 18 kDa protein; mitochondrial protein 18 kDa; mitochondrial fission protein MTP18
UniProt Protein Name
Mitochondrial fission process protein 1
Protein Family
UniProt Gene Name
MTFP1
UniProt Synonym Gene Names
MTP18; MTP18
UniProt Entry Name
MTFP1_HUMAN
NCBI Description
MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008]
Uniprot Description
MTP18: Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis. Belongs to the MTFP1 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Mitochondrial
Chromosomal Location of Human Ortholog: 22q
Cellular Component: mitochondrial inner membrane; integral to membrane
Biological Process: mitochondrial fission; apoptosis
Research Articles on MTFP1
1. Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
Similar Products
Product Notes
The MTFP1 mtfp1 (Catalog #AAA643516) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MTP18 (Myotubularin-related Protein 6 MTFP1, Mitochondrial Fission Process Protein 1, Mitochondrial 18 kDa Protein, HSPC242, My022) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTP18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MTFP1 mtfp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEPQPRGAE RDLYRDTWVR YLGYANEVGE AFRSLVPAAV VWLSYGVASS YVLADAIDKG KKAGEVPSPE AGRSARVTVA VVDTFVWQAL ASVAIPGFTI NRVCAASLYV LGTATRWPLA VRKWTTTALG LLTIPIIIHP IDRSVDFLLD SSLRKLYPTV GKPSSS. It is sometimes possible for the material contained within the vial of "MTP18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
