Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RP6-213H19.1 expression in transfected 293T cell line by RP6-213H19.1 polyclonal antibody. Lane 1: RP6-213H19.1 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MST4 Polyclonal Antibody | anti-MST4 antibody

MST4 (Mammalian STE20-like Protein Kinase 4, MST-4, Serine/threonine-protein Kinase MST4, STE20-like Kinase MST4, Mst3 and SOK1-related Kinase, MASK, Serine/threonine-protein Kinase MASK, RP6-213H19.1) APC

Gene Names
STK26; MASK; MST4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MST4; Polyclonal Antibody; MST4 (Mammalian STE20-like Protein Kinase 4; MST-4; Serine/threonine-protein Kinase MST4; STE20-like Kinase MST4; Mst3 and SOK1-related Kinase; MASK; Serine/threonine-protein Kinase MASK; RP6-213H19.1) APC; EC=2.7.11.1; anti-MST4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RP6-213H19.1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MST4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RP6-213H19.1, aa1-416 (NP_057626.2).
Immunogen Sequence
MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RP6-213H19.1 expression in transfected 293T cell line by RP6-213H19.1 polyclonal antibody. Lane 1: RP6-213H19.1 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RP6-213H19.1 expression in transfected 293T cell line by RP6-213H19.1 polyclonal antibody. Lane 1: RP6-213H19.1 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-MST4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,658 Da
NCBI Official Full Name
serine/threonine-protein kinase 26 isoform 1
NCBI Official Synonym Full Names
serine/threonine protein kinase 26
NCBI Official Symbol
STK26
NCBI Official Synonym Symbols
MASK; MST4
NCBI Protein Information
serine/threonine-protein kinase 26; STE20-like kinase 4; STE20-like kinase MST4; mammalian sterile 20-like 4; Mst3 and SOK1-related kinase; serine/threonine protein kinase MST4; serine/threonine-protein kinase MASK; mammalian Ste20-like protein kinase 4
UniProt Protein Name
Serine/threonine-protein kinase MST4
UniProt Gene Name
MST4
UniProt Synonym Gene Names
MASK; MST-4
UniProt Entry Name
MST4_HUMAN

NCBI Description

The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on MST4

Similar Products

Product Notes

The MST4 mst4 (Catalog #AAA6392860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MST4 (Mammalian STE20-like Protein Kinase 4, MST-4, Serine/threonine-protein Kinase MST4, STE20-like Kinase MST4, Mst3 and SOK1-related Kinase, MASK, Serine/threonine-protein Kinase MASK, RP6-213H19.1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MST4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MST4 mst4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MST4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.