Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Liver)

Rabbit MST1 Polyclonal Antibody | anti-MST1 antibody

MST1 antibody - middle region

Gene Names
MST1; MSP; HGFL; NF15S2; D3F15S2; DNF15S2
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MST1; Polyclonal Antibody; MST1 antibody - middle region; anti-MST1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
Sequence Length
711
Applicable Applications for anti-MST1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 77%; Dog: 85%; Horse: 85%; Human: 100%; Pig: 86%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MST1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Liver)

Immunohistochemistry (IHC) (Liver)

Immunohistochemistry (IHC)

(MST1 antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (MST1 antibody - middle region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-MST1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-MST1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-MST1 antibody
This is a rabbit polyclonal antibody against MST1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
Product Categories/Family for anti-MST1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
hepatocyte growth factor-like protein
NCBI Official Synonym Full Names
macrophage stimulating 1
NCBI Official Symbol
MST1
NCBI Official Synonym Symbols
MSP; HGFL; NF15S2; D3F15S2; DNF15S2
NCBI Protein Information
hepatocyte growth factor-like protein
UniProt Protein Name
Hepatocyte growth factor-like protein
Protein Family
UniProt Gene Name
MST1
UniProt Synonym Gene Names
D3F15S2; DNF15S2; HGFL; MSP
UniProt Entry Name
HGFL_HUMAN

NCBI Description

The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds. [provided by RefSeq, Jan 2010]

Uniprot Description

MSP: Probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved. Belongs to the peptidase S1 family. Plasminogen subfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3p21

Molecular Function: serine-type endopeptidase activity

Biological Process: sperm motility; spermatogenesis; proteolysis; embryo implantation

Research Articles on MST1

Similar Products

Product Notes

The MST1 mst1 (Catalog #AAA3207888) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MST1 antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MST1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the MST1 mst1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCHMPLTGYE VWLGTLFQNP QHGEPSLQRV PVAKMVCGPS GSQLVLLKLE. It is sometimes possible for the material contained within the vial of "MST1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.