Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded rat kidney using MSLN Antibody at dilution of 1:100 (40x lens).)
Rabbit anti-Human, Rat MSLN Polyclonal Antibody | anti-MSLN antibody
MSLN Polyclonal Antibody
Gene Names
MSLN; MPF; SMRP
Reactivity
Human, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
MSLN; Polyclonal Antibody; MSLN Polyclonal Antibody; MPF; SMRP; anti-MSLN antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRP
Sequence Length
622
Applicable Applications for anti-MSLN antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IF: 1:50 - 1:100
IHC: 1:50 - 1:200
IF: 1:50 - 1:100
Immunogen
Recombinant protein of human MSLN
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, GPI-anchor, Golgi apparatus, Lipid-anchor, Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded rat kidney using MSLN Antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded rat kidney using MSLN Antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-MSLN antibody
This gene encodes a preproprotein that is proteolytically processed to generate two protein products, megakaryocyte potentiating factor and mesothelin. Megakaryocyte potentiating factor functions as a cytokine that can stimulate colony formation of bone marrow megakaryocytes. Mesothelin is a glycosylphosphatidylinositol-anchored cell-surface protein that may function as a cell adhesion protein. This protein is overexpressed in epithelial mesotheliomas, ovarian cancers and in specific squamous cell carcinomas. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Product Categories/Family for anti-MSLN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67kDa/68kDa/71kDa
NCBI Official Full Name
mesothelin isoform 1 preproprotein
NCBI Official Synonym Full Names
mesothelin
NCBI Official Symbol
MSLN
NCBI Official Synonym Symbols
MPF; SMRP
NCBI Protein Information
mesothelin
UniProt Protein Name
Mesothelin
Protein Family
UniProt Gene Name
MSLN
UniProt Synonym Gene Names
MPF; MPF
NCBI Description
This gene encodes a preproprotein that is proteolytically processed to generate two protein products, megakaryocyte potentiating factor and mesothelin. Megakaryocyte potentiating factor functions as a cytokine that can stimulate colony formation of bone marrow megakaryocytes. Mesothelin is a glycosylphosphatidylinositol-anchored cell-surface protein that may function as a cell adhesion protein. This protein is overexpressed in epithelial mesotheliomas, ovarian cancers and in specific squamous cell carcinomas. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]
Uniprot Description
Membrane-anchored forms may play a role in cellular adhesion.
Research Articles on MSLN
Similar Products
Product Notes
The MSLN msln (Catalog #AAA9134109) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSLN Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MSLN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IF: 1:50 - 1:100. Researchers should empirically determine the suitability of the MSLN msln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAGETGQEAA PLDGVLANPP NISSLSPRQL LGFPCAEVSG LSTERVRELA VALAQKNVKL STEQLRCLAH RLSEPPEDLD ALPLDLLLFL NPDAFSGPQA CTRFFSRITK ANVDLLPRGA PERQRLLPAA LACWGVRGSL LSEADVRALG GLACDLPGRF VAESAEVLLP RLVSCPGPLD QDQQEAARAA LQGGGPPYGP PSTWSVSTMD ALRGLLPVLG QPIIRSIPQG IVAAWRQRSS RDPSWRQPER TILRP. It is sometimes possible for the material contained within the vial of "MSLN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
