Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Quality Control Testing:Antibody Reactive Against Recombinant Protein. |Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human CART1 Monoclonal Antibody | anti-ALX1 antibody

CART1 (ALX Homeobox Protein 1, Cartilage Homeoprotein 1, CART-1, ALX1)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CART1; Monoclonal Antibody; CART1 (ALX Homeobox Protein 1; Cartilage Homeoprotein 1; CART-1; ALX1); Anti -CART1 (ALX Homeobox Protein 1; anti-ALX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A10
Specificity
Recognizes human CART1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSS*
Applicable Applications for anti-ALX1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa198-307 from CART1 (NP_008913) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Quality Control Testing:Antibody Reactive Against Recombinant Protein. |Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Quality Control Testing:Antibody Reactive Against Recombinant Protein. |Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(CART1 monoclonal antibody Western Blot analysis of CART1 expression in Hela NE.)

Western Blot (WB) (CART1 monoclonal antibody Western Blot analysis of CART1 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged CART1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CART1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-ALX1 antibody
Transcriptional activator that acts at a palindromic recognition sequence to enhance the activity of the SV40 and TK promoters. Functions as a repressor with the prolactin promoter in vivo. May play a role in chondrocyte differentiation and may also influence cervix development.
Product Categories/Family for anti-ALX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
36,961 Da
NCBI Official Full Name
cartilage paired-class homeoprotein 1
UniProt Protein Name
ALX homeobox protein 1
Protein Family
UniProt Gene Name
ALX1
UniProt Synonym Gene Names
CART1; CART-1
UniProt Entry Name
ALX1_HUMAN

Uniprot Description

Function: Transcriptional activator that acts at a palindromic recognition sequence to enhance the activity of the SV40 and TK promoters. Functions as a repressor with the prolactin promoter in vivo. May play a role in chondrocyte differentiation and may also influence cervix development. Ref.4

Subunit structure: Interacts (via homeobox domain) with EP300

By similarity.

Subcellular location: Nucleus Ref.4.

Tissue specificity: Cartilage and cervix tissue.

Post-translational modification: Acetylated at Lys-131 by EP300, leading to increased interaction with EP300 and enhances transcriptional activation activity

By similarity.

Involvement in disease: Frontonasal dysplasia 3 (FND3) [MIM:613456]: The term frontonasal dysplasia describes an array of abnormalities affecting the eyes, forehead and nose and linked to midfacial dysraphia. The clinical picture is highly variable. Major findings include true ocular hypertelorism; broadening of the nasal root; median facial cleft affecting the nose and/or upper lip and palate; unilateral or bilateral clefting of the alae nasi; lack of formation of the nasal tip; anterior cranium bifidum occultum; a V-shaped or widow's peak frontal hairline.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.5

Sequence similarities: Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.

Similar Products

Product Notes

The CART1 alx1 (Catalog #AAA647126) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CART1 (ALX Homeobox Protein 1, Cartilage Homeoprotein 1, CART-1, ALX1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CART1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CART1 alx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QAKSHFAATY DISVLPRTDS YPQIQNNLWA GNASGGSVVT SCMLPRDTSS CMTPYSHSPR TDSSYTGFSN HQNQFSHVPL NNFFTDSLLT GATNGHAFET KPEFERRSS*. It is sometimes possible for the material contained within the vial of "CART1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.