Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MRPL3 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Rabbit MRPL3 Polyclonal Antibody | anti-MRPL3 antibody

MRPL3 antibody - N-terminal region

Gene Names
MRPL3; MRL3; RPML3; COXPD9
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRPL3; Polyclonal Antibody; MRPL3 antibody - N-terminal region; anti-MRPL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
Sequence Length
348
Applicable Applications for anti-MRPL3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MRPL3 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-MRPL3 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-MRPL3 antibody
This is a rabbit polyclonal antibody against MRPL3. It was validated on Western Blot

Target Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
Product Categories/Family for anti-MRPL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
39S ribosomal protein L3, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L3
NCBI Official Symbol
MRPL3
NCBI Official Synonym Symbols
MRL3; RPML3; COXPD9
NCBI Protein Information
39S ribosomal protein L3, mitochondrial
UniProt Protein Name
39S ribosomal protein L3, mitochondrial
Protein Family
UniProt Gene Name
MRPL3
UniProt Synonym Gene Names
MRL3; RPML3; L3mt; MRP-L3
UniProt Entry Name
RM03_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q. [provided by RefSeq, Jul 2008]

Uniprot Description

MRPL3: Defects in MRPL3 are the cause of combined oxidative phosphorylation deficiency type 9 (COXPD9). A mitochondrial disease characterized by failure to thrive, poor feeding, hypertrophic cardiomyopathy, hepatomegaly, and psychomotor retardation. Death in infancy has been observed in some cases. Belongs to the ribosomal protein L3P family.

Protein type: Mitochondrial; Ribosomal; Translation; RNA-binding

Chromosomal Location of Human Ortholog: 3q21-q23

Cellular Component: mitochondrial inner membrane; mitochondrial large ribosomal subunit

Molecular Function: structural constituent of ribosome; RNA binding

Biological Process: mitochondrial translation; translation; organelle organization and biogenesis

Disease: Combined Oxidative Phosphorylation Deficiency 9

Research Articles on MRPL3

Similar Products

Product Notes

The MRPL3 mrpl3 (Catalog #AAA3215703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPL3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRPL3 mrpl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPLWTKDGQK HVVTLLQVQD CHVLKYTSKE NCNGKMATLS VGGKTVSRFR. It is sometimes possible for the material contained within the vial of "MRPL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.