Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human MRPL13 Polyclonal Antibody | anti-MRPL13 antibody

MRPL13 (Mitochondrial Ribosomal Protein L13, L13, L13A, L13mt, RPL13, RPML13) (MaxLight 550)

Gene Names
MRPL13; L13; L13A; L13mt; RPL13; RPML13
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
MRPL13; Polyclonal Antibody; MRPL13 (Mitochondrial Ribosomal Protein L13; L13; L13A; L13mt; RPL13; RPML13) (MaxLight 550); Mitochondrial Ribosomal Protein L13; RPML13; anti-MRPL13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MRPL13.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MRPL13 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MRPL13 (NP_054797.2, 1aa-178aa) full-length human protein.
Immunogen Sequence
MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MRPL13 antibody
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq]
Product Categories/Family for anti-MRPL13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,692 Da
NCBI Official Full Name
39S ribosomal protein L13, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L13
NCBI Official Symbol
MRPL13
NCBI Official Synonym Symbols
L13; L13A; L13mt; RPL13; RPML13
NCBI Protein Information
39S ribosomal protein L13, mitochondrial; MRP-L13
UniProt Protein Name
39S ribosomal protein L13, mitochondrial
Protein Family
UniProt Gene Name
MRPL13
UniProt Synonym Gene Names
L13mt; MRP-L13
UniProt Entry Name
RM13_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq, Jul 2008]

Uniprot Description

MRPL13: a mitochondrial ribosomal protein encoded by a nuclear gene that helps in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq, Jul 2008]

Protein type: Translation; Mitochondrial; RNA-binding; Ribosomal

Chromosomal Location of Human Ortholog: 8q22.1-q22.3

Cellular Component: mitochondrial inner membrane; mitochondrial ribosome; mitochondrial large ribosomal subunit

Molecular Function: protein binding; structural constituent of ribosome

Biological Process: mitochondrial translation; translation; organelle organization and biogenesis

Research Articles on MRPL13

Similar Products

Product Notes

The MRPL13 mrpl13 (Catalog #AAA6451252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPL13 (Mitochondrial Ribosomal Protein L13, L13, L13A, L13mt, RPL13, RPML13) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MRPL13 mrpl13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MRPL13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.