Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MPZSample Tissue: Human Liver TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MPZ Polyclonal Antibody | anti-MPZ antibody

MPZ Antibody - middle region

Gene Names
MPZ; P0; CHM; DSS; MPP; CHN2; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; CMTDID; HMSNIB
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MPZ; Polyclonal Antibody; MPZ Antibody - middle region; anti-MPZ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKA
Sequence Length
248
Applicable Applications for anti-MPZ antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MPZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MPZSample Tissue: Human Liver TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MPZSample Tissue: Human Liver TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MPZ antibody
This gene is specifically expressed in Schwann cells of the peripheral nervous system and encodes a type I transmembrane glycoprotein that is a major structural protein of the peripheral myelin sheath. The encoded protein contains a large hydrophobic extracellular domain and a smaller basic intracellular domain, which are essential for the formation and stabilization of the multilamellar structure of the compact myelin. Mutations in this gene are associated with autosomal dominant form of Charcot-Marie-Tooth disease type 1 (CMT1B) and other polyneuropathies, such as Dejerine-Sottas syndrome (DSS) and congenital hypomyelinating neuropathy (CHN). A recent study showed that two isoforms are produced from the same mRNA by use of alternative in-frame translation termination codons via a stop codon readthrough mechanism.
Product Categories/Family for anti-MPZ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
myelin protein P0 isoform MPZ
NCBI Official Synonym Full Names
myelin protein zero
NCBI Official Symbol
MPZ
NCBI Official Synonym Symbols
P0; CHM; DSS; MPP; CHN2; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; CMTDID; HMSNIB
NCBI Protein Information
myelin protein P0
UniProt Protein Name
Myelin protein P0
Protein Family
UniProt Gene Name
MPZ
UniProt Synonym Gene Names
MPP
UniProt Entry Name
MYP0_HUMAN

NCBI Description

This gene is specifically expressed in Schwann cells of the peripheral nervous system and encodes a type I transmembrane glycoprotein that is a major structural protein of the peripheral myelin sheath. The encoded protein contains a large hydrophobic extracellular domain and a smaller basic intracellular domain, which are essential for the formation and stabilization of the multilamellar structure of the compact myelin. Mutations in this gene are associated with autosomal dominant form of Charcot-Marie-Tooth disease type 1 (CMT1B) and other polyneuropathies, such as Dejerine-Sottas syndrome (DSS) and congenital hypomyelinating neuropathy (CHN). A recent study showed that two isoforms are produced from the same mRNA by use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2015]

Uniprot Description

myelin P0: a structural protein in peripheral nervous system Schwann cells. Forms an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. Defects cause of Charcot-Marie-Tooth disease, Dejerine-Sottas syndrome, congenital hypomyelination neuropathy, and Roussy-Levy syndrome.

Protein type: Adaptor/scaffold; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.3

Cellular Component: integral to plasma membrane; plasma membrane; myelin sheath

Molecular Function: structural molecule activity

Biological Process: synaptic transmission; intercellular junction maintenance

Disease: Neuropathy, Congenital Hypomyelinating Or Amyelinating, Autosomal Recessive; Charcot-marie-tooth Disease, Demyelinating, Type 1b; Hypertrophic Neuropathy Of Dejerine-sottas; Charcot-marie-tooth Disease, Dominant Intermediate D; Charcot-marie-tooth Disease, Axonal, Type 2j; Charcot-marie-tooth Disease, Axonal, Type 2i; Roussy-levy Hereditary Areflexic Dystasia

Research Articles on MPZ

Similar Products

Product Notes

The MPZ mpz (Catalog #AAA3220772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPZ Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MPZ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MPZ mpz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AALQRRLSAM EKGKLHKPGK DASKRGRQTP VLYAMLDHSR STKAVSEKKA. It is sometimes possible for the material contained within the vial of "MPZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.