Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MPP6Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MPP6 Polyclonal Antibody | anti-MPP6 antibody

MPP6 Antibody - middle region

Gene Names
MPP6; VAM1; p55T; PALS2; VAM-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MPP6; Polyclonal Antibody; MPP6 Antibody - middle region; anti-MPP6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSI
Sequence Length
540
Applicable Applications for anti-MPP6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MPP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MPP6Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MPP6Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MPP6 antibody
Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily.
Product Categories/Family for anti-MPP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
MAGUK p55 subfamily member 6
NCBI Official Synonym Full Names
membrane palmitoylated protein 6
NCBI Official Symbol
MPP6
NCBI Official Synonym Symbols
VAM1; p55T; PALS2; VAM-1
NCBI Protein Information
MAGUK p55 subfamily member 6
UniProt Protein Name
MAGUK p55 subfamily member 6
Protein Family
UniProt Gene Name
MPP6
UniProt Synonym Gene Names
VAM1; VAM-1
UniProt Entry Name
MPP6_HUMAN

NCBI Description

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily (Tseng et al., 2001 [PubMed 11311936]).[supplied by OMIM, Mar 2008]

Uniprot Description

VAM-1: a membrane-associated of the MAGUK family. Interacts with Lin7, which localizes to postsynaptic densities of neurons and epithelial cell-cell junctions.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: membrane; plasma membrane

Molecular Function: protein binding; PDZ domain binding

Biological Process: protein complex assembly

Similar Products

Product Notes

The MPP6 mpp6 (Catalog #AAA3221972) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPP6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MPP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MPP6 mpp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSRKPREDEK DGQAYKFVSR SEMEADIKAG KYLEHGEYEG NLYGTKIDSI. It is sometimes possible for the material contained within the vial of "MPP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.