Western Blot (WB)
(WB Suggested Anti-MOV10L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Small Intestine)
Rabbit MOV10L1 Polyclonal Antibody | anti-MOV10L1 antibody
MOV10L1 antibody - N-terminal region
Gene Names
MOV10L1; CHAMP; DJ402G11.8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MOV10L1; Polyclonal Antibody; MOV10L1 antibody - N-terminal region; anti-MOV10L1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL
Sequence Length
1211
Applicable Applications for anti-MOV10L1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MOV10L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MOV10L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Small Intestine)
Western Blot (WB)
(WB Suggested Anti-MOV10L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Small Intestine)
Related Product Information for anti-MOV10L1 antibody
This is a rabbit polyclonal antibody against MOV10L1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-MOV10L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135kDa
NCBI Official Full Name
RNA helicase Mov10l1 isoform 1
NCBI Official Synonym Full Names
Mov10 like RISC complex RNA helicase 1
NCBI Official Symbol
MOV10L1
NCBI Official Synonym Symbols
CHAMP; DJ402G11.8
NCBI Protein Information
RNA helicase Mov10l1
UniProt Protein Name
Putative helicase Mov10l1
Protein Family
UniProt Gene Name
MOV10L1
UniProt Synonym Gene Names
MOV10-like protein 1
UniProt Entry Name
M10L1_HUMAN
NCBI Description
This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]
Uniprot Description
MOV10L1: Putative RNA helicase. Isoform 1 may play a role in male germ cell development. Belongs to the DNA2/NAM7 helicase family. SDE3 subfamily. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Helicase; EC 3.6.4.13
Chromosomal Location of Human Ortholog: 22q13.33
Cellular Component: intracellular
Molecular Function: RNA binding; magnesium ion binding; ATP binding; ATP-dependent RNA helicase activity
Biological Process: multicellular organismal development; spermatogenesis; gene expression; germ cell development
Research Articles on MOV10L1
Similar Products
Product Notes
The MOV10L1 mov10l1 (Catalog #AAA3203147) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOV10L1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MOV10L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MOV10L1 mov10l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNVGQEVIAV VEENKVSNGL KAIRVEAVSD KWEDDSRNHG SPSDCGPRVL. It is sometimes possible for the material contained within the vial of "MOV10L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
