Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PHOCNSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MOB4 Polyclonal Antibody | anti-MOB4 antibody

MOB4 Antibody - N-terminal region

Gene Names
MOB4; 2C4D; MOB1; MOB3; PHOCN; PREI3; CGI-95; MOBKL3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MOB4; Polyclonal Antibody; MOB4 Antibody - N-terminal region; anti-MOB4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELN
Sequence Length
193
Applicable Applications for anti-MOB4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PHOCN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PHOCNSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PHOCNSample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MOB4 antibody
This is a rabbit polyclonal antibody against PHOCN. It was validated on Western Blot

Target Description: This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.
Product Categories/Family for anti-MOB4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
MOB-like protein phocein isoform 2
NCBI Official Synonym Full Names
MOB family member 4, phocein
NCBI Official Symbol
MOB4
NCBI Official Synonym Symbols
2C4D; MOB1; MOB3; PHOCN; PREI3; CGI-95; MOBKL3
NCBI Protein Information
MOB-like protein phocein
UniProt Protein Name
MOB-like protein phocein
Protein Family
UniProt Gene Name
MOB4
UniProt Synonym Gene Names
MOB3; MOBKL3; PHOCN; PREI3; Mob3
UniProt Entry Name
PHOCN_HUMAN

NCBI Description

This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.[provided by RefSeq, Feb 2011]

Uniprot Description

PREI3: May play a role in membrane trafficking, specifically in membrane budding reactions. Belongs to the MOB1/phocein family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Activator; Membrane protein, peripheral; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 2q33.1

Cellular Component: Golgi apparatus; cell soma; perinuclear region of cytoplasm; cytoplasm; dendritic spine; cytosol

Molecular Function: protein binding; metal ion binding; kinase binding

Biological Process: transport

Research Articles on MOB4

Similar Products

Product Notes

The MOB4 mob4 (Catalog #AAA3217872) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOB4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MOB4 mob4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSTLAVQQY IQQNIRADCS NIDKILEPPE GQDEGVWKYE HLRQFCLELN. It is sometimes possible for the material contained within the vial of "MOB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.