Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MNAT1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateMNAT1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit MNAT1 Polyclonal Antibody | anti-MNAT1 antibody

MNAT1 antibody - C-terminal region

Gene Names
MNAT1; MAT1; TFB3; CAP35; RNF66
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
MNAT1; Polyclonal Antibody; MNAT1 antibody - C-terminal region; anti-MNAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
Sequence Length
309
Applicable Applications for anti-MNAT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MNAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MNAT1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateMNAT1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-MNAT1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateMNAT1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-MNAT1 antibody
This is a rabbit polyclonal antibody against MNAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7, cyclin H, and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
CDK-activating kinase assembly factor MAT1 isoform 1
NCBI Official Synonym Full Names
MNAT1 component of CDK activating kinase
NCBI Official Symbol
MNAT1
NCBI Official Synonym Symbols
MAT1; TFB3; CAP35; RNF66
NCBI Protein Information
CDK-activating kinase assembly factor MAT1
UniProt Protein Name
CDK-activating kinase assembly factor MAT1
UniProt Gene Name
MNAT1
UniProt Synonym Gene Names
CAP35; MAT1; RNF66
UniProt Entry Name
MAT1_HUMAN

NCBI Description

The protein encoded by this gene, along with cyclin H and CDK7, forms the CDK-activating kinase (CAK) enzymatic complex. This complex activates several cyclin-associated kinases and can also associate with TFIIH to activate transcription by RNA polymerase II. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

MNAT1: Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II.

Protein type: Nuclear receptor co-regulator; Cell cycle regulation; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 14q23

Cellular Component: nucleoplasm; holo TFIIH complex; cytoplasm

Molecular Function: RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; protein binding; zinc ion binding; protein N-terminus binding

Biological Process: transcription from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; positive regulation of smooth muscle cell proliferation; protein amino acid phosphorylation; regulation of gene expression, epigenetic; mRNA capping; negative regulation of gene expression, epigenetic; transcription-coupled nucleotide-excision repair; protein complex assembly; nucleotide-excision repair, DNA damage removal; G2/M transition of mitotic cell cycle; adult heart development; transcription initiation from RNA polymerase II promoter; ventricular system development; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; termination of RNA polymerase I transcription; DNA repair; regulation of transcription from RNA polymerase II promoter; cell proliferation; nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; gene expression; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; regulation of cyclin-dependent protein kinase activity; response to calcium ion; transcription initiation from RNA polymerase I promoter; G1/S transition of mitotic cell cycle; negative regulation of apoptosis

Research Articles on MNAT1

Similar Products

Product Notes

The MNAT1 mnat1 (Catalog #AAA3203928) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MNAT1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MNAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MNAT1 mnat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQIETYGPHV PELEMLGRLG YLNHVRAASP QDLAGGYTSS LACHRALQDA. It is sometimes possible for the material contained within the vial of "MNAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.