Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: 1. Normal HUman Cartilage (50ug)2. Human Osteoarthritis cartilage (50ug)3. Human Osteoarthritis chondrocytes (50ug)4. Human Osteoarthritis chondrocytes +IL-1 (50ug)Primary Dilution: 1:2000Secondary Antibody: HRP conjugated anti-rabbitSecondary Dilution: 1:5000Image Submitted By: Mukundan AtturNYU Hospital for Joint Disease)

Rabbit MMP13 Polyclonal Antibody | anti-MMP13 antibody

MMP13 antibody - middle region

Gene Names
MMP13; CLG3; MDST; MANDP1; MMP-13
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MMP13; Polyclonal Antibody; MMP13 antibody - middle region; anti-MMP13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
Sequence Length
471
Applicable Applications for anti-MMP13 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MMP13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: 1. Normal HUman Cartilage (50ug)2. Human Osteoarthritis cartilage (50ug)3. Human Osteoarthritis chondrocytes (50ug)4. Human Osteoarthritis chondrocytes +IL-1 (50ug)Primary Dilution: 1:2000Secondary Antibody: HRP conjugated anti-rabbitSecondary Dilution: 1:5000Image Submitted By: Mukundan AtturNYU Hospital for Joint Disease)

Western Blot (WB) (Sample Type: 1. Normal HUman Cartilage (50ug)2. Human Osteoarthritis cartilage (50ug)3. Human Osteoarthritis chondrocytes (50ug)4. Human Osteoarthritis chondrocytes +IL-1 (50ug)Primary Dilution: 1:2000Secondary Antibody: HRP conjugated anti-rabbitSecondary Dilution: 1:5000Image Submitted By: Mukundan AtturNYU Hospital for Joint Disease)

Western Blot (WB)

(Sample Type: Equine Cartilage Explants Primary Dilution: 1:1000 Secondary Antibody: Bio-Rad 170-5046 Secondary Dilution: 1:100,000Image Submitted By: Adam WilliamsUniversity of Nottingham)

Western Blot (WB) (Sample Type: Equine Cartilage Explants Primary Dilution: 1:1000 Secondary Antibody: Bio-Rad 170-5046 Secondary Dilution: 1:100,000Image Submitted By: Adam WilliamsUniversity of Nottingham)

Western Blot (WB)

(WB Suggested Anti-MMP13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-MMP13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-MMP13 antibody
This is a rabbit polyclonal antibody against MMP13. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as art

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
collagenase 3 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 13
NCBI Official Symbol
MMP13
NCBI Official Synonym Symbols
CLG3; MDST; MANDP1; MMP-13
NCBI Protein Information
collagenase 3
UniProt Protein Name
Collagenase 3
Protein Family
UniProt Gene Name
MMP13
UniProt Synonym Gene Names
MMP-13
UniProt Entry Name
MMP13_HUMAN

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP13: Degrades collagen type I. Does not act on gelatin or casein. Could have a role in tumoral process. Defects in MMP13 are the cause of spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO). A bone disease characterized by moderate to severe metaphyseal changes, mild epiphyseal involvement, rhizomelic shortening of the lower limbs with bowing of the femora and/or tibiae, coxa vara, genu varum and pear-shaped vertebrae in childhood. Epimetaphyseal changes improve with age. Defects in MMP13 are the cause of metaphyseal anadysplasia type 1 (MANDP1). Metaphyseal anadysplasia consists of an abnormal bone development characterized by severe skeletal changes that, in contrast with the progressive course of most other skeletal dysplasias, resolve spontaneously with age. Clinical characteristics are evident from the first months of life and include slight shortness of stature and a mild varus deformity of the legs. Patients attain a normal stature in adolescence and show improvement or complete resolution of varus deformity of the legs and rhizomelic micromelia. Belongs to the peptidase M10A family.

Protein type: Secreted; Secreted, signal peptide; EC 3.4.24.-; Protease

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: collagen binding; zinc ion binding; metalloendopeptidase activity; calcium ion binding

Biological Process: collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; cellular protein metabolic process; proteolysis; bone mineralization; endochondral ossification

Disease: Spondyloepimetaphyseal Dysplasia, Missouri Type

Research Articles on MMP13

Similar Products

Product Notes

The MMP13 mmp13 (Catalog #AAA3212721) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP13 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's MMP13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMP13 mmp13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HFMLPDDDVQ GIQSLYGPGD EDPNPKHPKT PDKCDPSLSL DAITSLRGET. It is sometimes possible for the material contained within the vial of "MMP13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.