Rabbit anti-Human MMP1 Polyclonal Antibody | anti-MMP1 antibody

MMP1 (Interstitial Collagenase, Fibroblast Collagenase, Matrix Metalloproteinase-1, MMP-1, CLG) (FITC)

Cat. Num. AAA6385591

• Gene Names: MMP1; CLG; CLGN
• Reactivity: Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MMP1; Polyclonal Antibody; MMP1 (Interstitial Collagenase; Fibroblast Collagenase; Matrix Metalloproteinase-1; MMP-1; CLG) (FITC); anti-MMP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MMP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-MMP1 antibody: Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length human MMP1, aa1-469 (NP_002412.1).
• Immunogen Sequence: MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MMP1 rabbit polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of MMP1 expression in transfected 293T cell line by MMP1 polyclonal antibody. Lane 1: MMP1 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of purified rabbit antibody to MMP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between MMP1 and F2R. HeLa cells were stained with anti-MMP1 rabbit purified polyclonal 1:1200 and anti-F2R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Product Categories/Family for anti-MMP1 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 4505215
• NCBI GeneID: 4312
• NCBI Accession #: NP_002412.1
• NCBI GenBank Nucleotide #: NM_002421
• UniProt Accession #: P03956; P08156
• Molecular Weight: 54,007 Da
• NCBI Official Full Name: interstitial collagenase isoform 1 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 1 (interstitial collagenase)
• NCBI Official Symbol: MMP1
• NCBI Official Synonym Symbols: CLG; CLGN
• NCBI Protein Information: interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1
• UniProt Protein Name: Interstitial collagenase
• Protein Family: Interstitial collagenase
• UniProt Gene Name: MMP1
• UniProt Synonym Gene Names: CLG; MMP-1
• UniProt Entry Name: MMP1_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

Uniprot Description

MMP1: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family.

Protein type: Protease; Secreted, signal peptide; EC 3.4.24.7; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: proteinaceous extracellular matrix; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity; endopeptidase activity; calcium ion binding

Biological Process: positive regulation of protein oligomerization; extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; cellular protein metabolic process; viral reproduction; blood coagulation; proteolysis; leukocyte migration

Disease: Epidermolysis Bullosa Dystrophica, Autosomal Recessive; Pulmonary Disease, Chronic Obstructive