Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of C17orf37 transfected lysate using C17orf37 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with C17orf37 mouse polyclonal antibody.)

Rabbit anti-Human MIEN1 Polyclonal Antibody | anti-MIEN1 antibody

MIEN1 (Migration and Invasion Enhancer 1, HBV X-transactivated Gene 4 Protein, HBV XAg-transactivated Protein 4, Protein C35, C17orf37, RDX12, XTP4, MGC14832)

Gene Names
MIEN1; C35; ORB3; XTP4; RDX12; C17orf37
Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
MIEN1; Polyclonal Antibody; MIEN1 (Migration and Invasion Enhancer 1; HBV X-transactivated Gene 4 Protein; HBV XAg-transactivated Protein 4; Protein C35; C17orf37; RDX12; XTP4; MGC14832); Anti -MIEN1 (Migration and Invasion Enhancer 1; anti-MIEN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C17orf37.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Applicable Applications for anti-MIEN1 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human C17orf37, aa1-115 (NP_115715.3).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of C17orf37 transfected lysate using C17orf37 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with C17orf37 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of C17orf37 transfected lysate using C17orf37 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with C17orf37 mouse polyclonal antibody.)
Related Product Information for anti-MIEN1 antibody
Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.
Product Categories/Family for anti-MIEN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,403 Da
NCBI Official Full Name
migration and invasion enhancer 1
NCBI Official Synonym Full Names
migration and invasion enhancer 1
NCBI Official Symbol
MIEN1
NCBI Official Synonym Symbols
C35; ORB3; XTP4; RDX12; C17orf37
NCBI Protein Information
migration and invasion enhancer 1; protein C17orf37; HBV XAg-transactivated protein 4; HBV X-transactivated gene 4 protein
UniProt Protein Name
Migration and invasion enhancer 1
UniProt Gene Name
MIEN1
UniProt Synonym Gene Names
C17orf37; RDX12; XTP4
UniProt Entry Name
MIEN1_HUMAN

Uniprot Description

MIEN1: Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process. Belongs to the SelWTH family.

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: selenium binding

Biological Process: positive regulation of filopodium formation; cell redox homeostasis; apoptosis; negative regulation of apoptosis; positive regulation of cell migration

Research Articles on MIEN1

Similar Products

Product Notes

The MIEN1 mien1 (Catalog #AAA6009810) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MIEN1 (Migration and Invasion Enhancer 1, HBV X-transactivated Gene 4 Protein, HBV XAg-transactivated Protein 4, Protein C35, C17orf37, RDX12, XTP4, MGC14832) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MIEN1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the MIEN1 mien1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGEPGQTSV APPPEEVEPG SGVRIVVEYC EPCGFEATYL ELASAVKEQY PGIEIESRLG GTGAFEIEIN GQLVFSKLEN GGFPYEKDLI EAIRRASNGE TLEKITNSRP PCVIL. It is sometimes possible for the material contained within the vial of "MIEN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.