Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MID2Sample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlMID2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Rabbit MID2 Polyclonal Antibody | anti-MID2 antibody

MID2 Antibody - C-terminal region

Gene Names
MID2; FXY2; RNF60; TRIM1; MRX101
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MID2; Polyclonal Antibody; MID2 Antibody - C-terminal region; anti-MID2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQ
Sequence Length
735
Applicable Applications for anti-MID2 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MID2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MID2Sample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlMID2 is supported by BioGPS gene expression data to be expressed in NCIH226)

Western Blot (WB) (Host: RabbitTarget Name: MID2Sample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlMID2 is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-MID2 antibody
This is a rabbit polyclonal antibody against MID2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-MID2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
probable E3 ubiquitin-protein ligase MID2 isoform 1
NCBI Official Synonym Full Names
midline 2
NCBI Official Symbol
MID2
NCBI Official Synonym Symbols
FXY2; RNF60; TRIM1; MRX101
NCBI Protein Information
probable E3 ubiquitin-protein ligase MID2
UniProt Protein Name
Probable E3 ubiquitin-protein ligase MID2
UniProt Gene Name
MID2
UniProt Synonym Gene Names
FXY2; RNF60; TRIM1
UniProt Entry Name
TRIM1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Feb 2009]

Uniprot Description

MID2: is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Feb 2009]

Protein type: Microtubule-binding; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: Xq22.3

Cellular Component: microtubule; cytoplasm

Molecular Function: protein homodimerization activity; zinc ion binding; protein heterodimerization activity; microtubule binding; phosphoprotein binding; ligase activity

Biological Process: negative regulation of viral transcription; positive regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of virion penetration into host cell; protein ubiquitination; innate immune response; positive regulation of transcription factor activity; activation of NF-kappaB transcription factor

Disease: Mental Retardation, X-linked 101

Research Articles on MID2

Similar Products

Product Notes

The MID2 mid2 (Catalog #AAA3213598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MID2 Antibody - C-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MID2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MID2 mid2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WGLWPEIRKC KEAVSCSRLA GAPRGLYNSV DSWMIVPNIK QNHYTVHGLQ. It is sometimes possible for the material contained within the vial of "MID2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.