Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using MIB2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit MIB2 Polyclonal Antibody | anti-MIB2 antibody

MIB2 Rabbit pAb

Gene Names
MIB2; ZZZ5; ZZANK1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
MIB2; Polyclonal Antibody; MIB2 Rabbit pAb; ZZANK1; ZZZ5; anti-MIB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVE
Applicable Applications for anti-MIB2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 300-580 of human MIB2 (NP_001164158.1).
Positive Samples
HeLa, BxPC-3, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat brain, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using MIB2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using MIB2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-MIB2 antibody
Background: The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion. [provided by RefSeq, Mar 2017]
Product Categories/Family for anti-MIB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
109,939 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MIB2 isoform 2
NCBI Official Synonym Full Names
mindbomb E3 ubiquitin protein ligase 2
NCBI Official Symbol
MIB2
NCBI Official Synonym Symbols
ZZZ5; ZZANK1
NCBI Protein Information
E3 ubiquitin-protein ligase MIB2; novelzin; skeletrophin; mindbomb homolog 2; mind bomb homolog 2; novel zinc finger protein; putative NF-kappa-B-activating protein 002N; zinc finger, ZZ type with ankyrin repeat domain 1; zinc finger ZZ type with ankyrin
UniProt Protein Name
E3 ubiquitin-protein ligase MIB2
UniProt Gene Name
MIB2
UniProt Synonym Gene Names
SKD; ZZANK1; Novelzin
UniProt Entry Name
MIB2_HUMAN

Uniprot Description

MIB2: E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; Ligase; Ubiquitin conjugating system; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 1p36.33

Cellular Component: early endosome; cytoplasm; ubiquitin ligase complex

Molecular Function: protein binding; signal transducer activity; zinc ion binding; ubiquitin-protein ligase activity; actin binding; ligase activity

Biological Process: Notch signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein ubiquitination

Research Articles on MIB2

Similar Products

Product Notes

The MIB2 mib2 (Catalog #AAA9143051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MIB2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MIB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the MIB2 mib2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASVTWADGTT NVYRVGHKGK VDLKCVGEAA GGFYYKDHLP RLGKPAELQR RVSADSQPFQ HGDKVKCLLD TDVLREMQEG HGGWNPRMAE FIGQTGTVHR ITDRGDVRVQ FNHETRWTFH PGALTKHHSF WVGDVVRVIG DLDTVKRLQA GHGEWTDDMA PALGRVGKVV KVFGDGNLRV AVAGQRWTFS PSCLVAYRPE EDANLDVAER ARENKSSLSV ALDKLRAQKS DPEHPGRLVV EVALGNAARA LDLLRRRPEQ VDTKNQGRTA LQVAAYLGQV E. It is sometimes possible for the material contained within the vial of "MIB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.